KEGG   Geobacillus sp. Y412MC61: GYMC61_2110Help
Entry
GYMC61_2110       CDS       T01101                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00071  Fatty acid degradation
gyc00072  Synthesis and degradation of ketone bodies
gyc00280  Valine, leucine and isoleucine degradation
gyc00310  Lysine degradation
gyc00362  Benzoate degradation
gyc00380  Tryptophan metabolism
gyc00620  Pyruvate metabolism
gyc00630  Glyoxylate and dicarboxylate metabolism
gyc00640  Propanoate metabolism
gyc00650  Butanoate metabolism
gyc00900  Terpenoid backbone biosynthesis
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
gyc01130  Biosynthesis of antibiotics
gyc01200  Carbon metabolism
gyc01212  Fatty acid metabolism
gyc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GYMC61_2110
   00630 Glyoxylate and dicarboxylate metabolism
    GYMC61_2110
   00640 Propanoate metabolism
    GYMC61_2110
   00650 Butanoate metabolism
    GYMC61_2110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GYMC61_2110
   00072 Synthesis and degradation of ketone bodies
    GYMC61_2110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GYMC61_2110
   00310 Lysine degradation
    GYMC61_2110
   00380 Tryptophan metabolism
    GYMC61_2110
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GYMC61_2110
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GYMC61_2110
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GYMC61_2110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gyc04147]
    GYMC61_2110
Enzymes [BR:gyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GYMC61_2110
Exosome [BR:gyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYMC61_2110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2802 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACX78726
Position
2132991..2134142
Genome map
AA seq 383 aa AA seqDB search
MVREAVIVEAVRTPVGKRNGVFRDVHPVHLAAVVLDEVVRRAGMDKGAVEDIVMGCVTPV
AEQGYNIGRLAALEAGFPIEVPAVQINRMCGSGQQAIHFAAQEIRSGDMDVTIAAGVESM
TKVPILSDGNEQTIPPSLHEKYEFIHQGVSAERIAKKYGLTREELDAYAYESHQRALAAL
REGKFRAEIVPVKGLDRDGREILVALDEGPRADTSPEALAALKPVFQEDGLITAGNASQM
SDGAAAVLLMEREAARRFGLKPKARIVAQTVVGSDPTYMLDGVIPATRQVLKKASLSIDD
IDLIEINEAFAPVVLAWQKEIGAPLEKVNVNGGAIALGHPLGATGAKLMTSLVHELERRG
GRYGLLTICIGHGMATATIIERE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtgaagcggtcattgtcgaagcggtcaggacgccggtcggcaagcggaacggc
gtcttccgggacgttcatccggtccatttggccgcggtggtgctcgatgaagtcgtgcgc
cgggccggcatggacaaaggggcggtggaagacatcgtcatgggctgcgtgacgccggtc
gccgaacaagggtacaacatcggccggctggcggcgcttgaggccggattcccgatcgaa
gtgccggcagtgcaaatcaaccgaatgtgcggctcggggcagcaggcgattcatttcgcc
gcccaggaaatccgctccggcgatatggatgtcacgatcgccgccggggtcgaaagcatg
acgaaagtgccgattttaagcgatggcaacgagcagacgattccgccgtcgcttcatgaa
aaatacgaattcatccaccagggcgtctcggctgagcggatcgccaaaaaatacggccta
acgcgcgaggagcttgacgcctacgcgtacgaaagccatcaacgcgccttggcggccttg
cgcgaagggaagtttcgcgcggaaatcgtcccggtgaaagggcttgaccgcgacgggcgc
gagatcctcgtcgcccttgacgaagggccgcgggccgatacatcgccggaagcgctcgcc
gcgctcaagccggtgtttcaagaagacggcctcatcaccgctggcaatgcgagccaaatg
agcgacggggcggccgctgtgcttttgatggaacgggaggcggcgaggcggttcggactg
aagccgaaagcgcgcattgtcgcgcaaacggtcgtcggctccgacccgacgtatatgctc
gatggcgtcattccggcgacgaggcaagtgctgaaaaaagccagcctctcgatcgatgac
atcgacctcattgaaatcaacgaagcgttcgccccggtcgtgctcgcctggcaaaaagaa
atcggcgctccgcttgagaaggtgaatgtcaacggcggcgccattgcgcttggccatccg
ctcggcgccaccggtgcgaagctcatgacgtcgcttgttcatgaacttgaacggcgcggc
ggtcgctatgggctattgacgatttgcatcggccacgggatggcgacggccacgatcatc
gagcgggagtaa

DBGET integrated database retrieval system