KEGG   Geobacillus sp. Y412MC61: GYMC61_2298Help
Entry
GYMC61_2298       CDS       T01101                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00360  Phenylalanine metabolism
gyc00362  Benzoate degradation
gyc00621  Dioxin degradation
gyc00622  Xylene degradation
gyc01100  Metabolic pathways
gyc01120  Microbial metabolism in diverse environments
gyc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gyc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    GYMC61_2298
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GYMC61_2298
   00622 Xylene degradation
    GYMC61_2298
   00621 Dioxin degradation
    GYMC61_2298
Enzymes [BR:gyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     GYMC61_2298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: ACX78903
Position
2340774..2341799
Genome map
AA seq 341 aa AA seqDB search
MKRAITITEVALRDGSHAIAHQYTTKQVATIAKALDEANVPYIEVSHGDGLGGSSLQYGL
SRTDEFELIETAVAVCRQAKIAVLLLPGIGTVKELKQAARLGAKMARIATHVTEADISAQ
HIAAAKELGMETVGFLMMAHMAPIEVLVHQARLMESYGADVVYVVDSAGALLPHEVKERV
RALRESLEIEVGFHAHNNLSLAMANTLAAIEEGATRVDGSVRCLGAGAGNTQTEVLVAVL
DRMGIPTGIDLYKMMDLAEQLVAPILPKAQEITRDSLTLGYAGVYSSFLLHAQRAARMFG
LDARDILIELGRRKVVGGQEDMIVDVAAEMARPKAAVGEGE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgagccattaccattacagaagtggcattgcgcgacggcagccatgccatcgcc
caccaatatacaacaaaacaagtggccacgatcgccaaagcgctcgatgaagcgaacgtt
ccgtatattgaagtgtcacatggagacggtttggggggatcttcgctgcagtatggcttg
tcgcggaccgatgaatttgagctgattgaaacagctgtggcggtttgccggcaggccaaa
attgcggtgctccttcttccaggcatcgggacggtcaaggaattgaagcaggccgcccgc
ctaggagcgaaaatggcgcgcatcgcgacccatgtgacggaggcggatatttcggcccag
catattgccgcggcaaaagagcttggtatggaaacagtcgggtttttaatgatggcgcat
atggcgcctatcgaggtgcttgttcatcaagcgcggcttatggaaagctacggggcggac
gtggtctatgtcgtcgattcagccggtgctctcttgccgcatgaagtgaaagagcgcgtt
cgagcattaagggaaagccttgaaattgaagtcggttttcacgctcataacaatttatca
ttggcgatggccaatacattggccgcgattgaggaaggagcgacgcgcgttgacggcagt
gtccgctgcctgggggccggtgccggcaacacacagacggaagtgctggtcgcggtgttg
gatcggatgggcattccgaccggcattgatttgtataaaatgatggatttagctgagcag
cttgtggcgccgatcttgccaaaagctcaggagattacgcgtgacagtttgacgctcgga
tatgctggcgtctattcaagcttccttcttcacgcgcagcgcgccgcccgaatgtttggc
ctcgatgctcgcgatattttaattgaactcggccggcggaaggttgtcggcgggcaggaa
gatatgatcgtcgacgtcgctgcggaaatggcgcgtccaaaagcggctgtaggagagggg
gagtaa

DBGET integrated database retrieval system