KEGG   Geobacillus sp. Y412MC61: GYMC61_2709
Entry
GYMC61_2709       CDS       T01101                                 

Definition
(GenBank) extracellular solute-binding protein family 1
  KO
K17318  putative aldouronate transport system substrate-binding protein
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gyc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GYMC61_2709
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gyc02000]
    GYMC61_2709
Transporters [BR:gyc02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative aldouronate transporter
    GYMC61_2709
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8
Other DBs
NCBI-ProteinID: ACX79291
Position
complement(2752418..2754067)
AA seq 549 aa
MLKKAFTALTAAALAVGMLAGCTDSQSSSSSGSGDSKEKNGVVTITTVRTLKDDTKFREG
EDLNNNPITRWSEKELGIKWKTLWTAPNDEQYHNKIRLALSSGQKLPDVFKVSDGQLIND
LIRSGKVMPVDEAIEKYASPRLKKIYEQFPEAFYPATVDGKRYGIPRFSGGNGSDSLLWI
RKDWLDKLGLQPPKTIEDLEKIMDAFVNKDPDGNGKKDTIGLTLASKNGLATWLADGSFI
FGAYGNYEPGSWSKGEDGKLVYGSVQPSMKKALAKLNEWYQKGYLDKEVGILDEQTAIKS
FVAGKSGIISAPPWAAGWPIADALKNNPGAVVEPYPLPSGPDGKIGRRGEGLVTGMFLFS
KDFKHMDKFFQYLDEAYAYVYNDSKYFKYGLAEGYDYVMKNGKPVYDDQEIPGGRLDPGA
YFITEAIPTVPYMLYDLVEELYTTKRQPKNAYEYTRIVSLGESFMKAATIVNQQNQYRIE
NEFTGPPTKTMQKRGEFLTKMERETFANIIYGRTPLSAFDDFVKKWEESGGEEITKEVNE
WYQSVKGAK
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgctaaaaaaagcgtttacagctttaaccgctgctgcattggcggttggaatgcttgcg
ggatgtacggacagccaatcttcttcgtccagcgggtctggagattcgaaagagaaaaat
ggcgttgtaaccattacaactgtccgcacattaaaggatgatacgaaatttcgagaggga
gaggatttgaacaacaatcctatcacacgatggtcggaaaaagaattggggattaaatgg
aaaacattgtggacagctccaaacgatgaacagtatcacaataaaattcgcttagcttta
tcatccggacagaaactgcctgacgtatttaaagtgtcagacgggcagttgatcaatgat
ttaattcgttccggaaaagtgatgccggtcgacgaagctattgagaaatatgcgtcaccg
agattgaaaaagatttatgagcaatttccggaagcgttttatccggcgactgtcgacgga
aaacgctatggaatcccacgattttctggaggcaatggttccgactccttgctttggatt
cgcaaagattggcttgataagttaggtcttcagccgcctaaaacaatcgaagatctcgag
aaaatcatggacgcgtttgtcaacaaagaccctgacggcaatgggaaaaaggatacgatt
ggcttgacgctggccagcaaaaacggattggcaacttggttggccgacggaagctttatt
ttcggtgcttatggcaactatgaacctggttcatggtcaaaaggcgaagatgggaaactt
gtctatggatcggtacagccgtctatgaaaaaagcgttggctaagctgaatgaatggtat
caaaaaggatacttggacaaagaagttggcattttggacgaacagacggcgatcaaaagc
tttgtcgctggaaaatcgggaatcatttctgctcctccttgggctgctggatggccaatc
gcagatgcgttgaaaaataatccaggagccgttgtggaaccatacccactgccgagtggt
ccggatggcaaaatcggccggcgtggcgagggattggttacaggcatgtttttgttcagc
aaagactttaaacatatggataaattcttccaatacttagatgaagcatacgcctatgtg
tataatgactcgaaatattttaaatacgggttggcggaaggttatgactatgtgatgaag
aacggcaagcctgtttatgatgaccaggaaattccagggggaagattggatccaggggct
tatttcattacggaagccattccgaccgttccgtacatgctgtatgatctagtcgaggag
ttgtatacaacgaagcgtcagccgaaaaacgcctatgagtatacacgaattgtatcttta
ggtgagtcgtttatgaaagcggctacaatcgtcaaccaacaaaatcaataccgtattgaa
aacgagtttacaggtccgcccactaaaacgatgcaaaaacgcggagagtttttgacgaaa
atggaacgtgaaacgtttgccaacatcatttacggacggacgccgctcagtgcatttgat
gacttcgtgaaaaaatgggaagaatctggaggcgaagaaataacaaaagaagtgaatgaa
tggtatcaatcggtaaaaggagcaaagtag

DBGET integrated database retrieval system