KEGG   Geobacillus sp. Y412MC61: GYMC61_2723Help
Entry
GYMC61_2723       CDS       T01101                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00010  Glycolysis / Gluconeogenesis
gyc00052  Galactose metabolism
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
gyc01130  Biosynthesis of antibiotics
Module
gyc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC61_2723
   00052 Galactose metabolism
    GYMC61_2723
Enzymes [BR:gyc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     GYMC61_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACX79305
Position
complement(2771371..2772423)
Genome map
AA seq 350 aa AA seqDB search
MNITYEKWSELNGNDILLFILTNDRGIKLSATNYGCIVTDIRVPDRNGNIENVALGFGRF
EPYLTNAPYFGAVIGRVAGRIRGASFELDGITYQLAKNENNNHLHGGPNGFHHVLWQAEP
VQRNNAVGVVFSYTSPDGEEGYSGTVHVQVEYWLNSDNEWIVTYRARSDKTTLVNLTNHT
YFNLSGNGKRDILDHMLTIQSSRVLELNEELIPTGRVLDVAGTPFDLRQGKTIREAVESG
HPQIELVGGGYDHPFWLDRHHDKEIVLSDPESGRILTVETDEVGVVVYTSNQLPEGLDLG
GVPSRKYLGICLETQGLPDAVHHPQFPSIVLPAGKERVSTTVYRFGVRSS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacatacgaaaaatggtccgaactgaatggaaacgatattctcttgttcatc
ttgacaaacgaccgtggcataaaactgtcggcgacaaactacggatgcatcgtgacggac
atccgcgttcccgaccggaacggcaatatcgaaaatgtcgcgctcgggtttggccggttt
gaaccgtatttaaccaacgccccttactttggtgcggtgatcggccgcgtggccggacgc
attcgcggggcgagcttcgaactagatggaatcacgtatcaattggcgaaaaacgaaaac
aacaaccacttgcacggcggcccgaacggattccatcacgtgctttggcaggcggaaccg
gttcagcgcaataatgcagtgggggtcgtgttttcatacacaagcccggacggggaagag
ggatattcgggaacggttcatgttcaagtggaatattggctgaatagtgacaacgaatgg
atcgtcacgtaccgggctcgttcagacaaaacgacgctcgtcaatttgacgaaccatacg
tattttaacttgagcggcaacggcaagcgtgatattttggatcacatgctgaccatccaa
agctcccgtgtgctggagctgaatgaggaactgattccgactggccgcgtcttggatgtc
gctggcacgccgtttgatttgcggcaaggaaagacgatacgggaggcggtcgaatccggg
catccgcaaattgaactcgtcggcgggggctatgaccatccgttttggctcgatcggcat
catgacaaagagattgtgctttccgatccggagagtgggcggatattgacagtcgagacg
gatgaagtcggcgtcgtcgtgtatacgtcgaatcagttgccggaagggttggatttgggc
ggcgtgccgtcgcggaaatatctcggcatttgcttagaaacacaagggttgccggatgca
gttcatcatccgcagtttccgtcgattgtattgccagctggcaaagagcgagtgtcaacg
acagtctatcggtttggcgtgcgatcgtcgtaa

DBGET integrated database retrieval system