KEGG   Paenibacillus sp. Y412MC10: GYMC10_0134Help
Entry
GYMC10_0134       CDS       T01100                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gym00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GYMC10_0134
DNA repair and recombination proteins [BR:gym03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     GYMC10_0134
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GYMC10_0134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH HHH_8 gp32 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: ACX62443
UniProt: D3E871
Position
156070..156669
Genome map
AA seq 199 aa AA seqDB search
MYYPEPIAKLIDAFTRLPGVGPKTAARLAFHVLNMKEDDVIDFAKALVSVKRNLHYCSVC
CNITDTDPCRVCQDKTRDASIICVVQDAKDLVAMERTKEFEGYYHVLHGAISPMEGIGPD
EIRLKELLTRLSDERVKELILATNANIEGEATAMYISRLVRPFDIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRRELN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtactatcctgaaccgatcgcgaagctcatcgatgcctttacgcgactgccgggtgtg
gggccgaaaacggccgcccgcctggcttttcatgttctgaacatgaaggaagatgacgtt
attgattttgccaaagcgctagtcagtgtcaaaaggaatctgcactactgctccgtctgc
tgcaacatcacggatacggatccatgccgggtatgtcaggacaagactcgggatgcttcg
atcatctgcgttgtacaggatgcgaaggatctggtggcgatggagcgcacgaaggaattc
gagggctactatcatgtcctccatggggccatatctccgatggaggggatcgggccggat
gaaatccgtctgaaggagctcctcacgcgcttaagtgacgaacgagtgaaagaactcatt
ttggcgacgaacgctaatatcgagggggaggcaacggcgatgtacatatcgcgcctggtc
cgtccctttgatattaaggtgactcgtattgcccatggactgccggttggcggtgacctg
gagtacgcagatgaagtgactttatccaaagcgcttgaaggtcgaagagaactgaactga

DBGET integrated database retrieval system