KEGG   Paenibacillus sp. Y412MC10: GYMC10_1000Help
Entry
GYMC10_1000       CDS       T01100                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00010  Glycolysis / Gluconeogenesis
gym00020  Citrate cycle (TCA cycle)
gym00620  Pyruvate metabolism
gym00640  Propanoate metabolism
gym00650  Butanoate metabolism
gym00680  Methane metabolism
gym01100  Metabolic pathways
gym01120  Microbial metabolism in diverse environments
gym01130  Biosynthesis of antibiotics
gym01200  Carbon metabolism
Module
gym_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_1000
   00020 Citrate cycle (TCA cycle)
    GYMC10_1000
   00620 Pyruvate metabolism
    GYMC10_1000
   00640 Propanoate metabolism
    GYMC10_1000
   00650 Butanoate metabolism
    GYMC10_1000
  Energy metabolism
   00680 Methane metabolism
    GYMC10_1000
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    GYMC10_1000
Enzymes [BR:gym01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     GYMC10_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_7 Fer4 Fer4_16 Fer4_17 Fer4_10 Fer4_2 Fer4_9 Fer4_21 Fer4_6 Fer4_8 ETF_QO Fer4_22
Motif
Other DBs
NCBI-ProteinID: ACX63298
UniProt: D3EF87
Position
1177870..1178892
Genome map
AA seq 340 aa AA seqDB search
MSILPQKNELGFFEIRLESIGGLGANLAGKMLAEAGVTGSGLNGSNFSSYGSEKKGSPVK
SFVRFCDPEVEIRDHSPIEQPHVVGVFHEALYKTIDVISGLQPDGTVLVNTARALSEVAI
DLNMTQGTLAVVDALNISVEEKTKVNTAMLGALFRICSFLDPDDMRQVIRTTFEKKLPHL
VEANVRTFDRGYNEVRFLSLGNGSALIDPIAFARPQPILGYETQELGGILNVTANSVLKD
LSGSRQGYLPEYKIEDCIHCAACDTVCPDFCIVWETKPDKRGNMQMFMKGIDYQYCKGCL
KCIEACPTTALAALLEEPHYAEQHRVPQSFPYLTAEGVRS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattttgcctcaaaagaatgaactgggatttttcgagatccgtctcgaatccatc
ggcgggcttggcgccaatctggccggaaaaatgctggccgaagccggggtcaccggctcc
ggacttaacggttcgaatttttccagctatggttcggagaaaaaagggtcgccggtgaag
agcttcgtaaggttctgcgatcccgaggtggaaatccgcgatcacagtcccattgagcag
ccgcatgtcgtcggcgtatttcatgaagccttgtataagacgatcgatgtcataagcgga
ttacagcctgatggaacggtgcttgtgaatacggcgcgagcgctgtccgaagtggccatt
gatctgaacatgacccagggaacgctggccgtagttgatgcgctgaacatttccgttgag
gaaaaaaccaaagtgaatacggccatgcttggggctttgttccggatttgcagctttcta
gacccggacgatatgcggcaggtgatccgcacaacatttgagaaaaagctgccccacctc
gtggaagcgaatgtgcggacctttgacagaggatataacgaagtccggttcctttccttg
ggaaacggctcagcgcttatagacccaatcgctttcgcaagaccgcagccgattcttgga
tatgaaacgcaggagctgggcgggattctgaacgttacggcgaacagtgtcctgaaggat
cttagcggctcccggcagggatatttgccagagtacaagatcgaggactgcattcactgt
gccgcctgcgatacggtatgtccggatttctgcatcgtgtgggagacgaagccggataag
cgcgggaatatgcagatgtttatgaaaggtatcgattatcagtattgcaaaggctgcctg
aagtgtatcgaagcttgtccgaccaccgctttggctgccctgttagaagaaccgcattat
gcggagcagcaccgtgtgccgcaatcgtttccctatttaactgcggagggagtccgatca
tga

DBGET integrated database retrieval system