KEGG   Paenibacillus sp. Y412MC10: GYMC10_1551Help
Entry
GYMC10_1551       CDS       T01100                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00260  Glycine, serine and threonine metabolism
gym00750  Vitamin B6 metabolism
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01120  Microbial metabolism in diverse environments
gym01230  Biosynthesis of amino acids
Module
gym_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC10_1551
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GYMC10_1551
Enzymes [BR:gym01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GYMC10_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HgmA
Motif
Other DBs
NCBI-ProteinID: ACX63835
UniProt: D3EKR5
Position
1829293..1830366
Genome map
AA seq 357 aa AA seqDB search
MPYEGLLQTYREYLPVNERTPLLTLKEGNTPLIKAVNLSEELGIDLHFKFEGLNPTGSFK
DRGMVMAVAKAMEEGSRTIMCASTGNTSAAAAAYAARGGLNCIVIIPNNNIALGKLAQAM
IYGAKVIAIEGNFDRALEIVREITAKHPISLVNSVNPYRIEGQKTAAFEVVDQLGKAPDV
LAIPVGNAGNISAYWKGFKEYHAAGKSASLPKMLGFEAEGAMAIVKGEPIPNPETVATAI
RIGNPASWKTAVAAAEESGGQINYVTDEEILEAYRKIASREGIFAEPGSAASIAGVYKMK
REGYFKGGESVVCVLTGHGLKDPNIAISTVNAEPLVVSDTESAVMDAIAKLEGAARV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatgaaggattgctgcaaacctacagagaatatttgccggtaaatgagcgtacc
ccgctgctaacgcttaaggaagggaataccccgctcatcaaagccgtgaatctatccgaa
gagctcggaatcgatttgcatttcaaattcgaagggctgaacccgacaggttcattcaaa
gaccgcgggatggtcatggccgtcgcgaaagcaatggaagaaggaagccgtaccatcatg
tgcgcttcgacgggcaatacatcggctgcggctgctgcttatgccgctcgcggcggatta
aactgcatcgtgatcattccgaacaacaatatcgcgctgggcaagctcgcgcaggcgatg
atttacggagcgaaggtgatcgcgattgaagggaactttgaccgcgcgctggaaatcgtt
cgcgagatcacggccaagcatccgatttcgctggtaaactccgtgaatccttatcgaatc
gaaggccagaagacggctgcattcgaagtcgttgaccagttgggcaaagctccggacgta
ctggccattccggtcggcaatgcggggaacatctccgcttactggaaaggatttaaagaa
taccacgcagcgggcaaatccgcttccctgccgaagatgcttgggttcgaggcggaaggc
gccatggctatcgtcaagggtgagcctattccgaatccggaaacggtagcgacggccatc
cgcatcgggaacccggccagctggaaaaccgcggttgccgccgctgaggaatccggtgga
caaattaactacgttacggacgaggaaatcttggaagcataccgcaaaatcgcatcgcgc
gaggggatttttgccgagccaggatcggccgcctccatcgcaggcgtttataaaatgaag
cgagagggatattttaaaggtggggaatccgttgtctgtgtgctgacaggacatgggctg
aaagatccgaatatcgcgatttctaccgtgaacgccgaaccgctcgtcgtatcggatacg
gaatcggccgtaatggatgccatcgctaagcttgaaggagctgcgcgggtatga

DBGET integrated database retrieval system