KEGG   Paenibacillus sp. Y412MC10: GYMC10_1557Help
Entry
GYMC10_1557       CDS       T01100                                 

Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gym00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    GYMC10_1557
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gym03400]
    GYMC10_1557
Enzymes [BR:gym01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     GYMC10_1557
DNA repair and recombination proteins [BR:gym03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     GYMC10_1557
    RecFOR pathway proteins
     GYMC10_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC
Motif
Other DBs
NCBI-ProteinID: ACX63841
UniProt: D3EKS1
Position
1842915..1843418
Genome map
AA seq 167 aa AA seqDB search
MRILGIDPGIAIVGFGFVDKVGSKVTPVQYGCIQTEAHTPDEERLHHVYEGMLQLIDKYE
PEAVAFEKLFFNRNVTTAMSVSQARGVLILAAVQRGLPIAEYTPMQVKQAIVGYGKAEKK
QVQEMVRMFLKLQSIPKPDDVADALAVAICHAHSYTLNSKLNEVLRK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcatattaggaatcgacccggggattgcgattgtgggcttcgggtttgtcgataag
gttggaagcaaagtcacgccggtccagtatggctgcatccagacggaagcccatacaccg
gatgaagagaggctgcatcacgtgtatgaaggcatgctgcagcttatcgataaatatgag
ccggaggccgttgcgttcgagaaattgttttttaaccgcaacgtcaccaccgcgatgtcc
gtatcccaggcgagaggagttctcatactggcggcggtccagcgcggactcccgattgca
gaatatacgcctatgcaggttaagcaggccatcgtcggctatggcaaggcggagaagaag
caggtacaggaaatggtcaggatgttcctgaagcttcagagcatcccaaagcccgacgat
gtggcggatgctctagccgtggcaatctgccacgcccattcctacacacttaattccaaa
ttaaatgaggtattgcgaaaatga

DBGET integrated database retrieval system