KEGG   Paenibacillus sp. Y412MC10: GYMC10_1919Help
Entry
GYMC10_1919       CDS       T01100                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00010  Glycolysis / Gluconeogenesis
gym00620  Pyruvate metabolism
gym00640  Propanoate metabolism
gym00680  Methane metabolism
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01120  Microbial metabolism in diverse environments
gym01130  Biosynthesis of antibiotics
gym01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_1919
   00620 Pyruvate metabolism
    GYMC10_1919
   00640 Propanoate metabolism
    GYMC10_1919
  Energy metabolism
   00680 Methane metabolism
    GYMC10_1919
Enzymes [BR:gym01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GYMC10_1919
Lipid biosynthesis proteins [BR:gym01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GYMC10_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACX64201
UniProt: D3E5Q1
Position
2244414..2246138
Genome map
AA seq 574 aa AA seqDB search
MNQTHSEILPSEVSHSNMKSYEQARSEFSWDEIERHFTWYETGKVNMAYEAIDRHVAEGR
GDKVALLYSDAAREETLTFAQLKEKSDKFGNVLRKYGVGKGDRVFIFMPRGPELYAGLLG
ILKVGAVVGPLFEAFMETAVKDRLEDSGAVALITTPALLSRVKRDELPELKHIFVVGEVE
EEDPRLVNYHEEVEAASSELEIEWLEREDGLIMHYTSGSTGKPKGVYHVQNAMVQHYYTG
KVVLDLREDDIYWCTADPGWVTGTSYGIFAPWLNGVTNVIRGGRFSPQDWYSTLVNNKVT
VWYSAPTAFRMLMGAGSDLIDQYDLSHVRHVLSVGEPLNPEVVRWGHKAYKQRIHDTWWM
TETGGQLICNYPGMAIKPGSMGRPLPGITAAILDDHGKEVAPYTMGNLAIKTPWPSMMRT
IWNNEAKYQEYFRIPGWYISGDSAYMDEDGYFWFQGRIDDVINSSGERIGPFEVESKLVE
HPAVAEAGVIGKPDVTRGEIIKAFISLREGYTPSQELKDEIYRFVKEGLSAHAAPREIEF
KDKLPKTRSGKIMRRVLKAWELDLPTGDLSTIED
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaacgcatagcgaaatattgccaagtgaagtatcacattccaatatgaagagt
tacgagcaggcacgctccgagttttcatgggacgaaatcgagagacattttacttggtat
gagacgggtaaagtaaacatggcgtacgaggcaatcgaccgtcatgtagcggagggacga
ggagacaaggtagcactcttgtacagtgacgccgcccgcgaggagactcttacttttgcg
caattgaaagagaaatccgacaagttcggcaatgtgctgcgcaaatatggcgtgggcaaa
ggcgatcgggtatttatctttatgccgcgcggccctgagctctatgccggtttgcttggt
attttgaaggttggtgccgtggtaggcccattgttcgaggcgttcatggagacggcggta
aaggatcgcttggaggatagcggagcggttgcgctgattacgacgcctgcgctgttgtcg
cgcgtgaaacgggatgagctccccgaactgaagcatatctttgtcgttggcgaagtggaa
gaagaggatccgcgtctagtaaactatcatgaggaagttgaagccgcatccagcgagctg
gagattgaatggctcgagcgggaagacggattgatcatgcactatacatcaggctcaacc
gggaaaccgaagggcgtgtatcacgttcagaacgcgatggtgcagcattattatacaggc
aaggttgttttggatttaagggaagacgatatatattggtgtacggcggacccgggttgg
gtaaccggtacgtcatacggtatttttgcgccatggttgaacggcgtgaccaatgtcatt
cgcggaggccgctttagcccgcaggactggtacagcacattggtaaacaacaaagtaacg
gtatggtacagcgcgccgactgccttccggatgttgatgggggcaggttccgatctcatc
gaccaatatgatttgagccatgtacggcatgtactgtccgttggcgagccgctcaacccc
gaggtggtgcgttggggacacaaggcttacaagcagcgtatccatgatacatggtggatg
acggagaccggggggcagctgatctgtaactatccggggatggcgatcaagccgggatcc
atggggcgtccgctgccgggcattacggcggcgatcctggacgatcacgggaaagaagtt
gctccatatacgatggggaacctggccatcaagacaccttggccgtccatgatgagaacc
atctggaataacgaagcgaagtatcaagagtatttccgtattccgggctggtacatttcc
ggcgactcggcctatatggacgaggatggatacttctggttccagggcagaatcgacgat
gtgatcaattcgtcaggggagcgaatcgggccattcgaggtggagagcaagctcgttgag
catccggccgtagccgaagccggcgttatcggtaagcctgatgtaacacgcggcgagatc
attaaggcctttatctccctgcgtgagggctatacgccttctcaggagctcaaggatgaa
atctatcgtttcgtgaaggaaggcctttccgcccatgctgccccgcgtgaaatcgagttt
aaggataaacttccgaagacgcgctccggtaagatcatgcggcgcgtattgaaagcctgg
gaactggatctgccgactggcgatctatccacgattgaagattaa

DBGET integrated database retrieval system