KEGG   Paenibacillus sp. Y412MC10: GYMC10_3530Help
Entry
GYMC10_3530       CDS       T01100                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00220  Arginine biosynthesis
gym00330  Arginine and proline metabolism
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01130  Biosynthesis of antibiotics
gym01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    GYMC10_3530
   00330 Arginine and proline metabolism
    GYMC10_3530
Enzymes [BR:gym01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GYMC10_3530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACX65767
UniProt: D3EJU4
Position
complement(4067547..4068467)
Genome map
AA seq 306 aa AA seqDB search
MTKKTKTIRLLMPQWQGGNNPNYSFGAELLAWLAPDNDQPLIHVPVQTYDGTPLVNENGM
NGRTQLLEQLKAAHHLIHAHKPDRIVMFGGDCLVEQAPFAYLNERYDGELGLIWIDAHSD
LVRYVGYDNGHTVPLGNLLGEGDEEFAKHVNIPLKPENVFIAGLATPTEQEAKVISEGFQ
KLGIGFAELDTDMIQRLGIRTAGTEELKNSTAPIKAWIKERGIKHLAIHLDLDVLDPKAF
RSLLFANPEEPFNLSPQGTMQLPQLLHLLKELSEETDVVGLGITEHLPWDSIYLKKLLGE
MPILNN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaacgaaaacgatacgcctgttaatgccgcaatggcaaggggggaacaac
cccaactactcttttggtgccgaactgcttgcttggctggctccggataatgatcaaccc
cttatccatgttcccgtccaaacctatgatggaacgcctcttgtaaacgagaacggtatg
aatggcagaacacagctgctcgaacagttaaaggcggctcatcatcttatccatgcacat
aagccggatcgcattgtcatgtttggcggtgattgcttggtcgaacaagctccttttgcc
tatttgaacgaacgatacgacggggagttaggtttaatctggatcgatgctcacagtgat
ttggtgaggtatgtaggctatgacaacgggcatacggtaccgcttgggaatctgttggga
gaaggggatgaggagtttgccaaacatgtgaacatccctctaaaacccgaaaacgtcttt
attgcaggattagcaacgcctaccgaacaagaagccaaggtgatctcggaaggattccaa
aagctaggcatcggttttgcggagctggacacagacatgattcagaggctgggcattcga
actgctggcaccgaggagttgaagaacagtactgcgcctattaaagcgtggattaaagaa
cgcggcattaagcacctggccattcacctcgatctggacgtgcttgatcccaaggcattc
cggtctttgctgttcgccaatcctgaagaacccttcaatttatctccccagggaaccatg
caattgccgcagctgcttcatctgctgaaagaactgtctgaagagaccgatgtcgtgggt
ttagggatcacggagcatctgccatgggattctatttatttgaagaaactgctgggtgaa
atgcctattttaaataactaa

DBGET integrated database retrieval system