KEGG   Paenibacillus sp. Y412MC10: GYMC10_4201Help
Entry
GYMC10_4201       CDS       T01100                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00020  Citrate cycle (TCA cycle)
gym00640  Propanoate metabolism
gym00660  C5-Branched dibasic acid metabolism
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01120  Microbial metabolism in diverse environments
gym01130  Biosynthesis of antibiotics
gym01200  Carbon metabolism
Module
gym_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gym_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYMC10_4201
   00640 Propanoate metabolism
    GYMC10_4201
   00660 C5-Branched dibasic acid metabolism
    GYMC10_4201
Enzymes [BR:gym01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GYMC10_4201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACX66428
UniProt: D3E6V5
Position
complement(4780686..4781846)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKQVLKQYGVAVPNGKVAFTVEEAVEAAQSLGSPVTVVKAQIHAGGRGKAGGV
KVAKNLDEVRAYAEEILGKVLVTHQTGPEGKEVKRLLIEEGCDIRKEYYIGVVVDRATGR
VVMMASEEGGTEIEEVAAATPEKIFKEVVDPAIGLQTFQARKLAYSINIPNELVGKAVQF
MLALYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALFRHKDILELRDLDEEDE
KEIEASKYDLSYIALDGNIGCMVNGAGLAMATMDIIKYYGGDPANFLDVGGGATTEKVTE
AFKIILSDPQVKGIFVNIFGGIMRCDVIATGVVEAAKQLGLTRPLVVRLEGTNVDLGKQI
LAESGLNIVPADSMADGAQKIVSLVQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaatatcaaggaaaacaagtactgaagcaatatggagtagctgttccg
aacggcaaggtagcgtttacggtggaagaagcagttgaagctgcgcaatctttgggcagt
cccgtaaccgttgtcaaagcgcagatccacgcaggcggccgcggtaaagccggcggcgtt
aaagtggcgaagaacctggacgaggttcgtgcttatgccgaagaaattctgggcaaggtg
ttggtgactcaccaaacgggtccggaaggcaaggaagtcaagcgtctccttattgaagag
ggctgcgatattcgcaaagagtactatatcggggtggtcgttgaccgcgctaccggccgt
gtcgtcatgatggcgtccgaggaaggcggtaccgaaatcgaagaggttgcagcagcaact
cctgagaaaattttcaaagaagtcgtggatccggcgatcggacttcaaacattccaagcg
cggaaattagcgtattccattaatattccgaatgaactggtaggtaaagccgttcagttc
atgctggccttgtataaggcatttgtagagaaggattgctctatcgctgaaatcaatccg
cttgtcgtaaccggtgacggaaacgtcatggctctcgatgccaaactcaatttcgattcc
aatgcgttgttccgtcataaggacatcttggaactgcgcgatctggatgaggaagacgag
aaggaaatcgaagcgtccaaatacgacttgagttacatagctctcgacggcaacatcggc
tgtatggttaacggcgcaggtcttgccatggctacgatggacatcatcaagtattatggc
ggcgaccctgccaacttccttgatgttgggggcggcgcaacaacggagaaggtaacggaa
gccttcaagattattttgtccgatcctcaagtaaaaggaatctttgtcaacattttcggc
ggcattatgcgttgcgacgttattgctaccggtgttgtcgaagcagcgaaacagctggga
ctgactcgtccgcttgttgtacgcttggaaggaacgaacgtagacctcggcaagcagatt
ttggctgagtccggtctgaatatcgtgcctgctgattccatggccgacggagcacagaag
atcgtctccctcgttcagtaa

DBGET integrated database retrieval system