KEGG   Paenibacillus sp. Y412MC10: GYMC10_5017Help
Entry
GYMC10_5017       CDS       T01100                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GYMC10_5017
Enzymes [BR:gym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     GYMC10_5017
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     GYMC10_5017
    1.1.1.-  
     GYMC10_5017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C Shikimate_DH F420_oxidored ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ACX67230
UniProt: D3EDM5
Position
complement(5676926..5677975)
Genome map
AA seq 349 aa AA seqDB search
MQALRWHGVKDLRLETIAEPQATNGKVKIKVEWCGICGSDLHEYVAGPIFIPENTPHALT
GEQAPVVMGHEFSGQVVEVGEGVTKFKAGDRVVVEPVFACGSCEACRQGKYNLCDKMGFL
GLAGGGGGFSEYVAADEHMVHKIPDSVSYEQGALVEPSAVALYAVRQSQLKAGDRAVVFG
AGPIGLLVIEALKAAGASEIYAVELSPERKQKAEELGAIVIDPKACDVVEELHRRTGAGV
DVAFEVTGVPPVLTQAINSTKIGGQIMIVSIFETSAPIVPNDIVMKERNITGIIGYRDVF
PAVISLMEKGFFPADKLVTQRIKLDEVIDQGFEALLKEKNQVKILVSAH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattgcgctggcatggagtaaaggacctgcgtttggagacgatcgcggagccg
caagctacgaacggaaaagtgaaaatcaaggtcgagtggtgcgggatttgtggcagtgat
ctgcatgaatacgtggccgggcctatatttatacctgagaatacgcctcacgcccttacc
ggagaacaggctccggtggttatgggacatgagttttccggccaggttgtagaggttggc
gaaggcgttacgaaattcaaggctggcgaccgcgtggttgtagagcctgtctttgcatgc
ggatcatgcgaagcttgcagacaagggaaatacaatctgtgcgacaaaatgggctttctc
gggctcgccggcggcggtggcggtttctccgaatatgtcgccgcggatgagcacatggtt
cataaaatcccggacagcgtttcttatgaacagggagctctggtggaaccttcggcagtc
gcgctgtacgccgtgcgccaaagccagttaaaggctggggatcgggcggtcgtattcggt
gccgggccgatcggcctgcttgtcatcgaagcattgaaggcggcgggagcatccgagatt
tacgccgtggagctgtccccggaacgcaagcagaaagccgaggaattgggggctatcgtc
attgatccgaaggcctgcgatgtggtagaagagcttcatcgccgtacaggtgccggagtc
gatgtggcattcgaggtgaccggggttccgccggttcttacccaagcgatcaactcgacg
aagatcggcggacagattatgattgtcagcatcttcgaaacctccgctccgatcgtgccg
aatgacatcgtgatgaaggaacgtaacattaccggaatcatcggctaccgcgacgtattc
ccggctgtgatcagcctgatggaaaaaggcttcttcccggcggataagctggtcacccag
cggatcaaactggatgaggttatcgaccagggctttgaggctctgctcaaagagaaaaac
caggtgaagatcctggtaagcgctcactaa

DBGET integrated database retrieval system