KEGG   Paenibacillus sp. Y412MC10: GYMC10_5743Help
Entry
GYMC10_5743       CDS       T01100                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gym00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GYMC10_5743
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gym03011]
    GYMC10_5743
Ribosome [BR:gym03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GYMC10_5743
  Bacteria
    GYMC10_5743
  Archaea
    GYMC10_5743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACX67950
UniProt: D3ELA2
Position
complement(6429284..6429616)
Genome map
AA seq 110 aa AA seqDB search
MEAKAHARSIRIAPRKAQLVVDLIRGKQVGEAIAILRHTPKAASPVVEKLLNSAIANAEH
NYSLDVTKLVVTQAYVNQGPTMKRFRPRAMGRASRINKRTSHITLVVAEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcacatgctagatcgattcgtattgctcctcgtaaagctcaactcgtt
gttgacttgatccgcggtaagcaagtcggcgaagcgatcgcaattcttcgtcacactccg
aaagctgcatctccggttgttgagaagcttttgaactcggctatcgcaaacgctgagcat
aactactctttggatgtaactaaattggttgtgacgcaagcttatgtcaaccagggaccg
actatgaaacgtttccgccctcgtgcgatgggacgtgcaagccggatcaataaacgcacc
agccacattactttggtggtagctgaaaaataa

DBGET integrated database retrieval system