KEGG   Halotalea alkalilenta: A5892_05425Help
Entry
A5892_05425       CDS       T04333                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
haa  Halotalea alkalilenta
Pathway
haa00071  Fatty acid degradation
haa00072  Synthesis and degradation of ketone bodies
haa00280  Valine, leucine and isoleucine degradation
haa00310  Lysine degradation
haa00362  Benzoate degradation
haa00380  Tryptophan metabolism
haa00620  Pyruvate metabolism
haa00630  Glyoxylate and dicarboxylate metabolism
haa00640  Propanoate metabolism
haa00650  Butanoate metabolism
haa00900  Terpenoid backbone biosynthesis
haa01100  Metabolic pathways
haa01110  Biosynthesis of secondary metabolites
haa01120  Microbial metabolism in diverse environments
haa01130  Biosynthesis of antibiotics
haa01200  Carbon metabolism
haa01212  Fatty acid metabolism
haa02020  Two-component system
Module
haa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:haa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A5892_05425
   00630 Glyoxylate and dicarboxylate metabolism
    A5892_05425
   00640 Propanoate metabolism
    A5892_05425
   00650 Butanoate metabolism
    A5892_05425
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A5892_05425
   00072 Synthesis and degradation of ketone bodies
    A5892_05425
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A5892_05425
   00310 Lysine degradation
    A5892_05425
   00380 Tryptophan metabolism
    A5892_05425
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A5892_05425
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A5892_05425
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A5892_05425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:haa04147]
    A5892_05425
Enzymes [BR:haa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A5892_05425
Exosome [BR:haa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A5892_05425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANF56974
UniProt: A0A172YCN4
Position
complement(1226136..1227440)
Genome map
AA seq 434 aa AA seqDB search
MEFEPIYVVDGARTPFLRARNAPGPFSAADLAVQAGRTLLARHPALEHRIDEVIIGCASP
SADEINIARVIALRLGLEERIPAWTVMRNCASGMQALDSAIANLQRGRAEVVLAGGVDAL
SRAPVLFSDAMVKWLSQWYAAKSMGQRLAALRRFRPAQLAPVIGLLKGLTDPVVGLSMGQ
TAENLAHRFGIDRTAMDRYAARSHRRVLEARTRAAFDAETVALVSGDGRFHAEDDGVRDD
SSEERLAKLRPVFDKPWGNVTAGNSSQVTDGAALLLLASERAVESLGLAPIGRITDSQWA
GLSPEQMGLGPVHAAIPILERHGLGLNELDLWEINEAFAAQVLACQAAWEDPDYCESAFG
TPAWGRLDDARLNVDGGAIAIGHPVGASGARIVLHLLHALAERDLSRGMASICIGGGQGG
AMLVENLKRTEVAR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgaaccgatctacgtagtcgatggagccaggacgccgttcctgcgcgcccgc
aatgcgccgggtccgttctccgccgcggatctcgccgtccaggcaggcagaacgctgctc
gcccgccaccccgcgctcgagcaccggatcgatgaggtaatcatcggctgcgcctcgccc
tctgccgacgagatcaacatcgccagggtgatcgccctgcgtcttggcctcgaggagcgc
attcccgcctggacggtgatgcgcaactgcgcctcggggatgcaggcgctggacagcgcg
atcgccaatctccagcgcggtcgcgccgaggtggtgctggccggcggagtggacgcgctg
tcgcgggcacccgttctgttctcggatgcgatggtcaagtggctctcgcaatggtatgcg
gccaagagcatgggccagcgactcgcggcgctcaggcgctttcgcccggcgcagctggcc
ccggtgatcggcctgctcaaggggctcaccgatccggtggtggggctctcgatgggccag
accgccgagaacctcgcccaccgcttcgggatcgatcgtaccgcgatggaccgctacgcc
gcgcgcagccaccgtcgcgtcctcgaggctcgcacccgcgctgccttcgacgccgagacg
gtggcgctggtcagcggcgatggtcggttccacgccgaggacgacggcgtgcgcgacgac
tcaagcgaagagcgcctggccaagctgcgcccggtgttcgacaaaccatggggcaacgtc
accgccggcaacagctcgcaggtcaccgacggtgccgcgctgctgctgctggcctcggag
cgtgcggttgagagcctcgggctcgcgccgatcgggcggatcaccgacagccagtgggcc
ggactctctcccgagcagatgggcctcggtccggtacatgcggcgatccccatcctcgag
cgccacggcctcgggctcaatgagctcgacctgtgggagatcaacgaagccttcgccgcc
caggtgctggcctgccaggccgcctgggaggacccggactactgcgagtcggccttcggc
acgcccgcatgggggcgcctcgacgacgcccggctcaacgtcgacggcggcgcgatcgcg
ataggccacccggtcggcgcctcgggagcgcgaatcgtgctccacctgctccatgccctc
gccgaacgagacctctcacgcggcatggcatcgatctgcatcggcggcggccagggcggc
gcgatgctggtggaaaacctcaaacgcacggaggttgcgcgatga

DBGET integrated database retrieval system