KEGG   Halotalea alkalilenta: A5892_06750Help
Entry
A5892_06750       CDS       T04333                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
haa  Halotalea alkalilenta
Pathway
haa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:haa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A5892_06750
Enzymes [BR:haa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A5892_06750
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A5892_06750
    1.1.1.-  
     A5892_06750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C F420_oxidored Shikimate_DH ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ANF57200
UniProt: A0A172YD70
Position
1540358..1541413
Genome map
AA seq 351 aa AA seqDB search
MKALRWYAAKDIRIEDLDEPKAEEGRVKIKVKWCGICGTDLHEYLAGPIFIPVDEPHPIT
GEKAPITLGHEFCGEIVEVGEGVTGYAVGDRVTVEPVLFDPNSKASRRGLYNLCDKLGFY
GLAGMGGGFSEYASVPASIVHRLPDSVSYEQGALTEPAAVAVHAVRESRFEVGDKAAVFG
AGPIGLLVVEALKAAGAHEIYVVELSAQRRARAAALGARVIDPASVDAVAEIVALTDGGV
DVAYEVTGVPAVLQQSIDCVRIQGETMIVSVWEKPAPIHPNQILFKERHLTGILGYRNVF
PATLALMEQGYFKPEDFVTRKIALTNVIEQGFTALIEEKDQVKILVSPEMS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacttaggtggtatgcggccaaggatattcgtatcgaggatttggatgagccg
aaggcagaggaaggccgtgtaaaaataaaggtgaaatggtgtggcatatgcggtaccgac
ctgcatgagtatctcgccgggccgatcttcattcccgtcgatgagcctcatcccattacc
ggtgaaaaggcgccgatcacgctgggtcatgagttctgtggtgagatcgtcgaagtgggc
gagggcgtcaccggttatgcggtgggcgatcgggtcacggtcgaaccggtccttttcgac
cccaactccaaggcaagccgccgagggctgtacaacctctgcgacaagctgggcttctac
ggtttggccgggatggggggaggcttttccgaatatgcttcggtgcccgcttccatcgtt
catcgtcttcccgattcggtcagctacgaacagggtgcgctcaccgagccggccgcggta
gcggtgcatgcggtacgcgagagtcgcttcgaagtcggagacaaagcggcggtattcggt
gctggtcccatcggtcttttggtggtcgaagcgctcaaggctgccggcgcccatgagatc
tacgtcgtcgagctttcggcgcagcgtcgcgcaagggccgcagcgctcggcgcgcgagtg
atcgatcccgcctccgtcgatgcggtggccgagatcgtcgcactcaccgacggaggcgtc
gatgtggcctacgaggtgactggcgttccagcggtcctgcagcagagcatcgactgcgtg
cgcattcagggcgaaacgatgatcgtcagcgtgtgggagaagcccgcgccgatccatccc
aaccagatcctgttcaaggagcgccatctcactggaatccttggctatcgcaatgtgttc
ccggccaccctcgctttgatggagcaggggtacttcaaaccagaggatttcgtgacccgt
aagatcgccctgacgaacgtgatcgaacaggggttcaccgcgctgattgaagagaaggat
caagtgaagattctggtttcgcccgagatgagctag

DBGET integrated database retrieval system