KEGG   Halotalea alkalilenta: A5892_09590Help
Entry
A5892_09590       CDS       T04333                                 

Definition
(GenBank) hypothetical protein
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
haa  Halotalea alkalilenta
Pathway
haa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:haa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    A5892_09590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:haa03400]
    A5892_09590
Enzymes [BR:haa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A5892_09590
DNA repair and recombination proteins [BR:haa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     A5892_09590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 PDDEXK_1 AAA_25 AAA_30 RPA_interact_N AAA_11 ResIII
Motif
Other DBs
NCBI-ProteinID: ANF57686
UniProt: A0A172YEZ9
Position
2161011..2164778
Genome map
AA seq 1255 aa AA seqDB search
MALMDQPLDIPRLPLSGRRLIEASAGTGKTYTIAALYVRLVLGHGSEHGFARPLAPSEIL
VVTFTRAATEELRERIRARLREARDALLGRLPPDATLAALLAEYQGDVALAQARRLDQAV
RMMDDAAIFTIHGFCQRMLKRHAFDSGTRFAVELTAEGSALFEQGLEDYWRRHFYPLDSD
AQALIQSYWEGPAALSEALAIPLGADVERRLLWRGKEGEALVEAPGSVLDALAPCRAGLA
RAADAAARVRAAFDSQALEALFEQALAEKVFAANRVSKASLAPRLDALRQWCAGHAPLLP
QALLDDKGRAWLGAARLEAAAKKGCQPPEHALFDALDALAECQAGLVDARPALIAHALEV
IERELAARKRSEALLDFDDLLVELDQALAGPLGERLARSIRAELPVALIDEFQDTDARQY
RIFERIYPGGPGAGAPGVQGSEAMPHALLLIGDPKQAIYAFRNADVGTYLAARQRVEARY
TLKRNFRSSVAMVEAVNRLFSLSSMPFRDPGIVFTPSEAQGRAERLACDGETIAALTCWL
PASDASVDRASYLRTMSEAVRADIQRLLEGAGAGRAGFVGEQGSLVPLRAADIAILVRTG
TEALAVREALARGGIKSVYLSQKASVFETQEAFWLLQLLEAVAQPKRDRALRAAIATRLL
SDQLDEVARLIDDERHWESMVERFEDYHRDWRRVGVLAMIRRVMHDFDVGARLLARDDGE
RILTDLLHLAELAQSASQALDGEQALLRWLHRALSGRFERGLDPEALIQRLESDEELVRV
VTIHKSKGLEYPLVYLPFPCDYRRLDRPQGPLVVDHPEYGRVVALAPDDGLVALADEARL
AEDLRLLYVALTRARYACRIGIAPLYKGRRLRGDDDDATTLEHSALGTLLNDGAALGGRV
LRERLEALADGRVIALAPPPEPPPRPLVATSEPLVPRQARRFGGEIARGWWISSYTALVE
DARRGDGDEETPGIALLPAGLDLEVSDERTPVPAPPLGRINDFPRGPRAGTFLHTLLEAL
DFDRLAEPDYRIELDALVEHRLRRSAFDPGWRQPLQEWLGRLLGASLDPELPGLRLDALG
AWKAELEFWLPVAPTQAGHIDRLIRRFEPLGAEADYPTLAPRRLEGMLRGFIDLVFCFEG
RWYLLDWKSNHLGDSGEAYREQGLLQAIVSHRYDVQYVLYTLALHRHLRVRIEDYDYERH
FGGVLYLFLRGVDAERTDQGVFRRRPSPVLIEALDRLLAGDASVGVAVEEIANGG
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcatggaccaaccgctggatatcccccgtcttccgctcagcggccgccgcctg
atcgaggccagcgccggtaccggcaagacctacaccatcgccgcgctctacgttcgcctg
gtgctcggccacggctcggagcacggcttcgcacgcccgctcgcgccgagcgagatcctg
gtcgtcaccttcactcgcgccgccaccgaggagctgcgcgagcgcattcgcgcgcgcctg
cgcgaggcacgcgatgcgctgctcgggcgccttccaccggatgcgacactggcggcgctg
cttgccgagtaccagggcgacgtggccctcgcccaggcgcggcgtctcgaccaggcggta
cggatgatggatgacgcggcgatcttcaccatccacggcttttgccagcggatgctcaag
cgtcatgccttcgacagcggcacccgcttcgcggtcgaactcaccgccgagggatccgcg
ctgttcgaacaggggctcgaggactactggcggcggcacttctatccgctcgacagcgac
gcccaggcgttgatccagagctactgggaagggcccgccgcgcttagcgaggcgctggcg
ataccgctcggcgccgatgtcgagcgtcggctgctgtggcgcgggaaggagggcgaggcg
ctggtcgaggcgcctggctcggtgttggatgcgctggctccgtgccgtgccgggctggcc
cgtgccgccgacgcggcggcacgggtgcgcgcggctttcgattcgcaggccctcgaagca
ctgttcgagcaagcgctggcggagaaggtctttgccgccaaccgggtctccaaggcaagc
ctcgcacctcggctcgatgcgctgcgccagtggtgtgccggccatgcgccgctgctgccc
caggcgctgctcgacgacaaggggcgcgcctggctcggcgcggcgcggctcgaggcggcg
gcgaagaaaggatgccagccgccggagcatgcgctgttcgacgcgctcgatgcgctcgcc
gagtgccaggccgggctggtcgacgcccgcccggcgctgatcgcccatgcgctggaagtg
atcgagcgcgagctcgccgcgcgaaagcgcagcgaggcgctgctcgatttcgacgatctg
ctggtcgagctcgaccaggccctggccggcccgctcggcgaacgactcgcgcgcagcatc
cgcgccgagctgccggtagcgctgatcgacgagttccaggacaccgacgctcgccagtac
cggatcttcgagcggatctatccagggggacccggcgctggcgcgcccggtgtccagggc
agtgaggccatgccccatgcgctgctgttgatcggtgatcccaagcaggcgatatatgcc
tttcgcaatgccgatgtaggcacctatcttgccgctcgccagcgggtcgaggcgcgctat
acgctgaagcgcaacttccgctcgagcgtggcgatggtcgaggcggtcaatcgcctgttt
tcgctctcatcgatgccctttcgcgatcccggcatcgtgttcaccccgagcgaggcgcaa
gggcgtgccgagcgattggcctgcgacggcgagaccatcgcggcgttgacctgctggctg
ccggcgtcggacgcgagcgtggaccgcgctagctacctgcgtacgatgagcgaggcggtg
cgggcggacatccagcggctgctcgaaggggccggcgctggccgggccggcttcgtcggc
gagcagggcagcctggttccgctgcgcgccgccgatatcgccatcctggtgcgcaccggc
accgaggcgctggcggtgcgcgaggcgctcgcccgcggtgggatcaagagcgtctacctg
agccagaaggcctcggtgttcgagacccaggaagcgttctggctgctccagctgctcgag
gcggtggcgcagcccaagcgtgatcgcgcgctgcgcgcggcgatcgccacccgattgctc
tccgaccagctcgatgaggtcgctcggctgatcgatgacgaacgccattgggagtcgatg
gtcgagcgtttcgaagactatcaccgcgactggcgtcgggtcggcgtactggcgatgatc
cgccgggtgatgcatgacttcgatgtcggcgcgcggctgctcgcccgggacgacggcgag
cgcatcctcaccgacctgctccatctcgccgagctggcccagagcgcgagccaggcgctc
gatggtgaacaggcgctgctgcgctggctgcaccgcgcgctgagcgggaggttcgagcgt
gggctcgaccccgaggcgctgatccagcggctggaaagcgacgaggagctggtgcgggtg
gtgaccatccacaagtccaaggggctcgagtatccgctggtctacctgccgtttccctgc
gattaccggcggctcgaccggccgcaaggcccgctggtggtcgatcaccccgagtatggc
cgggtggtggcgctggcgcccgacgatggactggtcgcgctcgccgacgaggctcgtctg
gccgaggatctgcgcctgctctatgtggcgctgacccgggcccgctacgcttgccgtatc
ggcatcgcgccgctttacaaaggccgtcgcctgcgcggtgacgacgatgacgccaccacg
ctcgagcatagcgcgctgggcacattgctcaatgatggtgccgcgctcggcggccgcgtg
ctgcgtgagcggctcgaagcgctggccgatggccgagtgatcgcgctcgcgccgcctccc
gagccgccgccgcggcccctggtggcaacgtccgagcctcttgtaccgcgccaggcgcgg
cgcttcggcggcgagatcgcccgcggctggtggatctcctcctataccgcgctggtcgag
gatgcccggcgcggcgacggcgatgaggagacgcccggcatcgcgctgttgcccgcgggg
ctcgatctcgaggtatctgatgagcgcacgccggtgcccgcgccgccgctgggccggatc
aacgactttcccaggggcccgcgtgccggcaccttcctgcacacgctgctcgaggcgctc
gacttcgaccggctggccgagccggactaccgtatcgagctcgatgcgctggtcgaacac
cggctccggcgcagtgccttcgatcccggctggcgacagccgctgcaagagtggctcggg
cgactgctcggcgcgtcgctcgaccccgagcttcccgggctgcgtctcgatgcgctgggg
gcgtggaaggccgagctcgaattctggctgccggtggcaccgacccaggccgggcatatc
gatcggctgatccgccgtttcgagccgctaggcgcagaggcggactatccgacccttgca
cccaggcggctcgaaggcatgctgcgcggcttcatcgacctggtgttctgcttcgagggg
cgctggtacctgctcgactggaagtccaaccatctgggcgatagcggtgaggcctaccgg
gagcaggggctgctccaggcgatcgtcagccaccgctacgacgtccagtacgtgctctac
accctggcgctacatcgtcacctgagggtacggatcgaggactacgactacgagcgtcac
ttcggcggcgtgctctatctgttcctgcgcggggtggacgcggagcgcaccgaccaaggg
gtattccggcgccgtccttcgccggtgttgatcgaggcgctcgaccggctgctggcgggg
gatgcaagcgtcggggtggctgtcgaggagatcgcaaatggcggctag

DBGET integrated database retrieval system