KEGG   Halotalea alkalilenta: A5892_14820Help
Entry
A5892_14820       CDS       T04333                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
haa  Halotalea alkalilenta
Pathway
haa00260  Glycine, serine and threonine metabolism
haa01100  Metabolic pathways
haa01110  Biosynthesis of secondary metabolites
haa01120  Microbial metabolism in diverse environments
haa01130  Biosynthesis of antibiotics
haa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:haa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A5892_14820
Enzymes [BR:haa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A5892_14820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ANF58585
UniProt: A0A172YHW2
Position
complement(3316670..3317779)
Genome map
AA seq 369 aa AA seqDB search
MTKDPTGSRQTRHELSDQAASPRFLASDNTSGICPQALEYLLAANRGDVPAYGNDDWTAR
ASNRFRELFETDCEVFFVFNGTAANSLALATLCQPYQSVICHQLAHIETDECGGPEFFSN
GAKLLSVPGDDGKVAPLDVERMVVRRRDIHYPQPRALSITQSTEVGTLYRPDELAALREM
ADRHGLKVHMDGARFANACAALDLPPRALSWEAGVDVLCFSGTKNGTAVGEAVIFFDREL
ARGFEYRCKQAGQLASKMRFIAAPWLGLIETGAWCTNAVHANAMARHLGTGLEQLGLTPM
FPVQANAVFVDLPAKAQRYLKDKGWTFYTFIGDGGARFVCAWDTSKEAVDALLEDVRAGL
AGVGMQSAG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaggatccaaccggcagtcggcagacacggcacgaattgtcggatcaggccgcc
tcgccgcgttttctcgccagcgacaacacttcgggaatatgccctcaggcgcttgaatat
ctgctcgcagccaatcgaggcgatgtgcctgcctacggtaacgacgactggaccgcgcgt
gcttctaaccgcttccgtgagctgttcgagaccgactgcgaagtgttcttcgtgttcaat
ggcaccgcggcgaactcgttggccttggcgacgctctgccagccctatcagtcggtgatc
tgtcatcagctcgcccatatcgaaaccgatgaatgtggcgggccggagttcttctccaat
ggtgccaagctgctcagcgtacccggcgacgatggcaaggtggcgcctttggacgtcgaa
cgcatggtggtgcgtcggcgggacatccactacccgcagccgcgagcgctgtcgattacc
cagtccaccgaggtgggcactctctatcgtcccgatgagctcgcagcgctacgtgaaatg
gcggaccggcatggactcaaggtgcacatggatggtgcgcgctttgccaacgcctgcgcc
gcgctcgatctgccgcctcgggcgctgagctgggaagccggggtcgatgtgctgtgcttt
tcgggtaccaagaacggtaccgcggtcggtgaagcggtgatcttcttcgatcgcgagctg
gcccgaggcttcgaataccgctgcaagcaggcggggcagctggcttccaagatgcgtttc
atcgccgcgccttggctcgggctgatcgaaaccggtgcttggtgcactaatgcggtgcat
gctaacgccatggcacgccatctcggaactggtttggagcaacttggcctcaccccgatg
tttccggtacaggcaaacgcggtattcgttgatctgccagcgaaagcgcagcgctacctg
aaggacaagggctggacgttctataccttcattggtgacggcggggcacgcttcgtctgc
gcttgggataccagcaaggaagcggtcgatgcgctgctcgaggacgttcgcgcgggattg
gccggcgtcgggatgcaaagcgccggatga

DBGET integrated database retrieval system