KEGG   Haloarcula sp. CBA1115: SG26_07250Help
Entry
SG26_07250        CDS       T03645                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
hab  Haloarcula sp. CBA1115
Pathway
hab00260  Glycine, serine and threonine metabolism
hab00630  Glyoxylate and dicarboxylate metabolism
hab00670  One carbon pool by folate
hab01100  Metabolic pathways
hab01110  Biosynthesis of secondary metabolites
hab01130  Biosynthesis of antibiotics
hab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SG26_07250
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SG26_07250
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SG26_07250
Enzymes [BR:hab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     SG26_07250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AJF25538
UniProt: A0A0B5GVD4
Position
1459839..1460924
Genome map
AA seq 361 aa AA seqDB search
MTVLESVHEAHGATFREVGGRRVVDNYGRPERTHRAVRNVVGAMEYGYGVIVVTGEDRVD
YVDNAVSNRVPDDDGAGCYALLLDPDGRVDTDMYVYNAGERLLVFTPPQKAEDLAAEWAD
KTFIQDVEFEEATDDFAVFGVHGPKATEKIASVLHQTGTPPAPLTFERGELGDAGVSVIR
TDNLAGEESYDVVCSADDAEAVFDTLVNRGLNAVPFGYRTWETLTLEAGTPLFDTEIEGA
LPNDLGLRNALDFEKGCYVGQEVVSRIENRGHPTQRLVGLAVEECPESGAAVFAGDEHVG
DVTRAGQSPMREAPIALANLSWERPEDALTIRIDGEPVSAQQVDLPFIDGSAQSARLPTY
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactgttctcgagtccgttcacgaggcccacggagcgacattcagggaggtcggtggt
cggcgcgtcgtcgacaactacgggcgaccggagcggacccaccgcgcagttcggaacgtc
gtcggggcgatggagtacggctacggcgtgattgtcgtcaccggcgaggaccgcgtcgac
tacgtcgacaacgccgtctcgaaccgcgtgccagacgatgacggcgcgggctgttacgcg
ctcctgctcgaccccgacggccgcgtcgacacggacatgtacgtgtacaacgccggcgag
cgcctgctcgtgttcacaccgccccagaaagccgaggaccttgccgcagagtgggcggac
aagacgttcattcaggacgtcgagttcgaggaggcgaccgacgacttcgccgtcttcggc
gtccacgggccgaaagcgacagagaaaatcgccagcgttctccaccagaccgggaccccg
cccgcgccgctgaccttcgagcggggcgaactcggcgacgccggcgtctccgtcatccgg
acggacaacctcgccggcgaggagagctacgacgtggtctgtagcgctgacgacgccgag
gctgtcttcgacacgctggtcaaccgggggctcaacgccgtccccttcggctaccggacc
tgggagacgctgacgttagaggccgggacgccgctgttcgacaccgaaatcgagggcgcg
ctcccgaacgatcttggcctgcggaacgccctggacttcgagaagggctgttacgtcggt
caggaggtcgtctcgcgaatcgagaaccgcggccaccccacgcaacgtctggtcggcctc
gccgtcgaggaatgccccgagtccggtgccgcagtgttcgccggcgacgagcacgtcggc
gacgtgacccgtgccggccagagcccgatgcgggaagccccgattgcgctggcgaatctc
agttgggaacggcccgaagacgcgctgaccatccgcatcgacggtgaaccggtcagcgca
cagcaggtcgacctgccctttatcgacggctcggcgcagtcggcgcggttgccgacctac
gagtag

DBGET integrated database retrieval system