KEGG   Helicobacter acinonychis: Hac_0013Help
Entry
Hac_0013          CDS       T00371                                 

Gene name
trpA
Definition
(GenBank) (P56141) Tryptophan synthase alpha chain (EC 4.2.1.20); High confidence in function and specificity
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hac  Helicobacter acinonychis
Pathway
hac00260  Glycine, serine and threonine metabolism
hac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hac01100  Metabolic pathways
hac01110  Biosynthesis of secondary metabolites
hac01130  Biosynthesis of antibiotics
hac01230  Biosynthesis of amino acids
Module
hac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hac_0013 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hac_0013 (trpA)
Enzymes [BR:hac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hac_0013 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth AMIN ThiG
Motif
Other DBs
NCBI-ProteinID: CAJ98881
UniProt: Q17ZP5
Position
complement(16548..17321)
Genome map
AA seq 257 aa AA seqDB search
MFETLKKQEKMAFIPFVTLGDPDYELSFEIIKTLIASGVSALELGFAFSDPVADGITIQA
SHLRALKHASMAKNFQLLKKIRDYDSHIPIGLLAYANLIFSYGVDSFYAQAKECGTDSVL
IADMPLIEKELVIKSAQKHQIKQIFIASPNASVKDLEQVALNSQGYIYTLARSGVTGASH
ALENDASAVIKTLKTFSPIPALLGFGISKKEHIKNAKGMGADGVICGSALVKIIEENLNN
ENAMLEKIKGFIEEMVF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaactttgaaaaaacaagaaaaaatggcgtttatcccgtttgtaaccttgggc
gatcctgattatgaactgagttttgaaatcattaaaactttaattgctagcggtgtgagc
gctttagagttaggttttgctttctcagatcctgtagctgatggcatcactatacaagcg
agccatttaagggcgttaaaacacgcttctatggctaaaaatttccaacttttaaaaaaa
attagagattatgattctcatattcccatagggcttttagcgtatgcgaatttaattttt
tcttatggcgttgatagtttttacgctcaagctaaagaatgcggtacagatagcgtttta
atagcggatatgcccctgatagaaaaagaattagtcatcaaatccgctcaaaaacaccaa
attaaacaaatctttatcgctagccctaatgcgagcgttaaggatttagaacaagtagcc
ctaaattcgcaaggctatatttacactttagccaggagtggggttactggggcaagtcat
gctttagaaaatgatgcgagcgctgttattaaaaccttaaaaacttttagccctatccct
gcattactgggctttggaatctctaaaaaagaacacatcaaaaacgctaaaggcatgggg
gctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaagaaaatttgaataat
gaaaacgccatgctagaaaaaattaaggggtttatagaagaaatggttttttga

DBGET integrated database retrieval system