KEGG   Helicobacter acinonychis: Hac_0209Help
Entry
Hac_0209          CDS       T00371                                 

Gene name
algC
Definition
(GenBank) (P26276) Phosphomannomutase/phosphoglucomutase (EC 5.4.2.8) (EC 5.4.2.2) (PMM / PGM); High confidence in function and specificity
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hac  Helicobacter acinonychis
Pathway
hac00010  Glycolysis / Gluconeogenesis
hac00030  Pentose phosphate pathway
hac00051  Fructose and mannose metabolism
hac00052  Galactose metabolism
hac00230  Purine metabolism
hac00500  Starch and sucrose metabolism
hac00520  Amino sugar and nucleotide sugar metabolism
hac00521  Streptomycin biosynthesis
hac01100  Metabolic pathways
hac01110  Biosynthesis of secondary metabolites
hac01120  Microbial metabolism in diverse environments
hac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hac_0209 (algC)
   00030 Pentose phosphate pathway
    Hac_0209 (algC)
   00051 Fructose and mannose metabolism
    Hac_0209 (algC)
   00052 Galactose metabolism
    Hac_0209 (algC)
   00500 Starch and sucrose metabolism
    Hac_0209 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    Hac_0209 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    Hac_0209 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hac_0209 (algC)
Enzymes [BR:hac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hac_0209 (algC)
    5.4.2.8  phosphomannomutase
     Hac_0209 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV DUF844
Motif
Other DBs
NCBI-ProteinID: CAJ99059
UniProt: Q17Z67
Position
complement(176660..178048)
Genome map
AA seq 462 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMRKYDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNAINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKEIQALKDTLLSTKHKIQPLKEIPEKVNALEAYHRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIEFSSLYSDPDGNFPNHHPDPSEAKNLQDLQVHMQKNAMAVGFAF
DGDADRIAMLSSHHTYAGDELAILFAKRLHAQGITPFVIGEVKCSQMMYNTINTFGKTLM
YKTGHSNLKIKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPKIKGIINIDGVRVVFKHG
FGLIRASNTTPFLVTRFEGKDEKTALEYKRALLGLLQISSMK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttatccgaccactttagat
gaaaagagcgcttttagtatcggcgtggagttaggaaaaatcatgcggaaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgttttttgtttgaagctttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacgccggta
gcgtattttgcagcttttaatgcaatcaatggtatccaatgccctaactctatcatgatc
accggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggagattcaagctttaaaagacacgcttttaagcactaaacacaaaatc
caacctttaaaagaaatcccagaaaaagtcaatgctctagaagcgtatcaccgctatttg
atcaaggattttaagcatttaaagaatcttaaatacaagattgctttagattttggtaat
ggcgtgggggcgttaggactagagcctattttaaaggctttaaacattgaatttagcagc
ctttatagcgatcctgatggcaattttcctaaccaccacccagaccctagcgaagcgaaa
aacttacaggatttgcaagtgcacatgcaaaaaaacgctatggctgtaggctttgctttt
gatggcgatgcggacaggattgcgatgctaagctctcatcacacttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcattactccctttgtgataggc
gaagtcaaatgctctcaaatgatgtataacacgattaacacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaacttaaagaaaccaatgcacattttgcg
gctgaaatgagcgggcatatctttttcaaagagcgttattttggctatgatgacgctctt
tatgcatgtttaagggctttagaattattgcttgaacaaagtccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacttgcaagaagcacttaaaaacccgccaagtcat
ttccctaaaatcaaagggataattaacattgatggcgtgagagtggtttttaaacatggt
tttgggcttattcgtgcaagcaacaccaccccctttttagtcactcgctttgaaggcaag
gatgaaaaaacggcgttagaatataaaagggcgttgcttgggttgcttcaaatttcttct
atgaagtaa

DBGET integrated database retrieval system