KEGG   Helicobacter acinonychis: Hac_0554Help
Entry
Hac_0554          CDS       T00371                                 

Gene name
aimE
Definition
(GenBank) aliphatic amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
hac  Helicobacter acinonychis
Pathway
hac00330  Arginine and proline metabolism
hac00360  Phenylalanine metabolism
hac00380  Tryptophan metabolism
hac00627  Aminobenzoate degradation
hac00643  Styrene degradation
hac01100  Metabolic pathways
hac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Hac_0554 (aimE)
   00360 Phenylalanine metabolism
    Hac_0554 (aimE)
   00380 Tryptophan metabolism
    Hac_0554 (aimE)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Hac_0554 (aimE)
   00643 Styrene degradation
    Hac_0554 (aimE)
Enzymes [BR:hac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     Hac_0554 (aimE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Cdc13_OB4_dimer
Motif
Other DBs
NCBI-ProteinID: CAJ99374
UniProt: Q17YA2
Position
486213..487232
Genome map
AA seq 339 aa AA seqDB search
MRHGDISSSPDTVGVAVVNYKMPRLHTKEQVLENCRNIAKVIGGVKQGLPGLDLIIFPEY
STHGIMYDKQEMFDTAVSIPGEETAILAEACKKNKVWGVFSLTGEKHEQAKKNPYNTLIL
VNDKGEIVQKYRKILPWCPIECWYPGDKTYVVDGPKGLKVSLIICDDGNYPEIWRDCAMR
GAELIVRCQGYMYPAKEQQIAIVKAMAWANQCYVAVANATGFDGVYSYFGHSSIIGFDGH
TLGECGEEENGIQYAQLSVQQIRDARKYDQSQNQLFKLLHRGYSGVFASGDGDKGVAECP
FEFYKTWVNDPKKAQENVEKFTRPSVGVAACPVGDLPTK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagacatggagatattagtagcagtccagatactgtgggtgtagcggtagtcaattat
aagatgcctaggcttcacactaaagaacaggtgttagaaaattgccgtaatatcgctaag
gtgattggtggggttaaacaaggtctgccaggattggatctcattattttccctgaatac
agcacgcatgggattatgtatgacaaacaagagatgtttgacacagctgtgagtattcct
ggagaagaaacagcgatacttgctgaggcttgtaagaaaaataaggtttggggcgtgttc
tctttaactggggaaaaacacgagcaagctaaaaaaaatccctataacactttgattctt
gtcaatgataagggtgagattgtgcaaaaataccgcaaaatcttaccttggtgtcctatt
gaatgttggtatcctggggataaaacttatgtggttgatgggcctaagggcttgaaagtt
tctttgattatttgcgatgatggtaactaccctgagatttggcgcgattgtgcgatgcgt
ggggcagaactcattgtgcgctgtcaaggctatatgtatccagctaaagagcaacaaatt
gcgatagtgaaagctatggcgtgggctaatcaatgttatgtagccgtggcgaatgcgacc
ggttttgatggggtgtattcctattttgggcattctagcattattggttttgacgggcac
actttgggcgaatgcggagaagaagaaaatgggattcaatacgctcagctctctgtgcaa
caaatccgtgatgcgagaaaatacgaccaaagccaaaaccagctcttcaaactcttacac
agaggttatagtggggtttttgctagtggtgatggggataagggtgtggcggaatgccct
tttgagttctacaaaacttgggttaatgaccccaaaaaagctcaagaaaatgtagaaaaa
ttcactcgcccaagcgtgggtgtggccgcttgtcctgtaggcgatttgcccacgaaataa

DBGET integrated database retrieval system