KEGG   Helicobacter acinonychis: Hac_0605Help
Entry
Hac_0605          CDS       T00371                                 

Gene name
metS
Definition
(GenBank) (P56127) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA ligase) (MetRS); High confidence in function and specificity
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hac  Helicobacter acinonychis
Pathway
hac00450  Selenocompound metabolism
hac00970  Aminoacyl-tRNA biosynthesis
hac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Hac_0605 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hac_0605 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hac01007]
    Hac_0605 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hac03016]
    Hac_0605 (metS)
Enzymes [BR:hac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Hac_0605 (metS)
Amino acid related enzymes [BR:hac01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Hac_0605 (metS)
Transfer RNA biogenesis [BR:hac03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Hac_0605 (metS)
 Prokaryotic type
   Other AARSs
    Hac_0605 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: CAJ99416
UniProt: Q17Y60
Position
531922..533853
Genome map
AA seq 643 aa AA seqDB search
MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAK
LRNQSPKAYADSISAIFKNQWDFFNLDYDGFIRTTDNEHQKCVQNAFEIMFEKGDIYKGT
YSGYYCVSCESYCAISKADNINNKVLCPDCLRETTLLEEESYFFRLSAYEKPLLEFYAKN
PEVILPIYRKNEVTSFIEQGLLDLSITRTSFEWGILLPKKMNDPKHVVYVWLDALLNYAS
ALGYLNGLENKMVHFECARHIVGKDILRFHAIYWPAFLMSLGLPLFKQLCVHGWWTIEGV
KMSKSLGNVLDAQKLAMEYGIEELRYFLLREVPFGQDGDFSKKALVERINANLNNDLGNL
LNRLLGMAKKYFNYSLKSEKITTYYPKELEKVHQILDNANSFVPKMQLHKALEELFGVYD
FLNKLIAKEEPWVLHKNNESEKLEALLSLIANALLQSSFLLYAFMPKSAMKLASAFNVKI
TPTNYERFFKSKNLQDIILQDTEPLFSKMEKVGETTPAKKEEEKTPEEKTPQKQENYISI
DDFKKVEIKVGLIKEAQRVEKSNKLLRLKVDLGENRLRQIISGIALDYEPENLIGQMVCV
VANLKSAKLMGEMSEGMILAVRDNDSLALISPTKEKTAGSLIS
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcactgatcacaacccccatttattatgtgaatgatatcccccatattggt
catgcttatacgactttgattgcagacactctaaagaagtattacacgcttcaaggcgaa
gaagtcttttttttaactggcaccgatgagcatgggcaaaagattgaacaaagtgcgaaa
ttaagaaatcaaagccctaaagcttacgccgatagcattagcgcgatttttaaaaaccaa
tgggattttttcaatttagattatgatggttttatccgcaccacagataatgaacatcaa
aaatgcgtgcaaaacgcttttgaaatcatgtttgaaaaaggggatatttataaaggtact
tatagtgggtattattgcgtgagttgtgagagttattgcgcgatctctaaagcggataat
ataaacaataaagtcttatgccctgattgtttgagagagaccacgcttttagaagaagag
agttatttttttagattgagtgcatatgaaaaacctttattagagttttatgccaaaaac
cctgaagtgatcttgcccatttatcgtaaaaatgaagtcacttcttttattgaacaaggc
ttgttggatctatctatcacgcgcacaagctttgaatggggcattcttttacctaaaaaa
atgaatgatcctaaacatgtggtgtatgtttggctagacgctttattgaattatgcgagc
gcgttggggtatttgaatggtttagaaaataaaatggtgcattttgagtgcgctaggcat
attgtgggtaaggatattttacgcttccatgccatttattggccagcctttttgatgagc
ttgggtttgcccttattcaaacagctttgcgtgcatgggtggtggacgatagagggcgtg
aaaatgagtaagagcttgggtaatgttttagacgctcaaaagcttgctatggagtatggg
attgaagaattgcgctattttttattgcgtgaagtaccttttgggcaagatggggatttt
tctaaaaaagcgttagtagaaaggatcaacgccaatttgaacaacgatttggggaattta
ttgaatcgtttgttaggcatggctaaaaaatattttaactattctttaaaaagcgaaaaa
atcaccacatattaccctaaagagttagaaaaagtgcatcaaattttagataacgctaac
tcttttgtgcctaaaatgcaattgcataaagcgttagaagaattgtttggcgtttatgat
tttttaaacaaactcatcgctaaagaagagccatgggttttgcataaaaacaacgaatca
gaaaaattagaagccttattgagtttgattgcaaacgcgcttttacaatcaagcttttta
ctctatgcgttcatgccaaagagtgctatgaaattagcgagcgcttttaatgtaaaaatc
acgcccacaaattacgaacgctttttcaagtctaaaaatttacaagatataatcttgcaa
gacaccgagcccttattctctaaaatggaaaaagtgggggaaacaaccccagccaaaaaa
gaagaagaaaaaacgccagaagaaaaaaccccacaaaaacaagaaaactatatcagtatt
gatgatttcaaaaaagtagaaattaaagtggggcttatcaaagaggctcaaagggttgaa
aagtccaataaattactgcgcttaaaggtggatttaggtgaaaatcgtttgaggcagatt
atttcagggatcgctttggattatgagcctgaaaatttaatcggtcaaatggtgtgcgtg
gtggctaatttaaaatccgcaaagcttatgggcgaaatgagtgagggcatgattttagcg
gtgcgagataatgacagtttggccttaattagccccacaaaagaaaaaaccgcaggaagt
ctcattagctaa

DBGET integrated database retrieval system