KEGG   Helicobacter acinonychis: Hac_0958Help
Entry
Hac_0958          CDS       T00371                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase (EC 2.3.1.9) (Acetoacetyl-CoA thiolase); High confidence in function and specificity
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hac  Helicobacter acinonychis
Pathway
hac00071  Fatty acid degradation
hac00072  Synthesis and degradation of ketone bodies
hac00280  Valine, leucine and isoleucine degradation
hac00310  Lysine degradation
hac00362  Benzoate degradation
hac00380  Tryptophan metabolism
hac00620  Pyruvate metabolism
hac00630  Glyoxylate and dicarboxylate metabolism
hac00640  Propanoate metabolism
hac00650  Butanoate metabolism
hac00900  Terpenoid backbone biosynthesis
hac01100  Metabolic pathways
hac01110  Biosynthesis of secondary metabolites
hac01120  Microbial metabolism in diverse environments
hac01130  Biosynthesis of antibiotics
hac01200  Carbon metabolism
hac01212  Fatty acid metabolism
hac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hac_0958 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    Hac_0958 (atoB)
   00640 Propanoate metabolism
    Hac_0958 (atoB)
   00650 Butanoate metabolism
    Hac_0958 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hac_0958 (atoB)
   00072 Synthesis and degradation of ketone bodies
    Hac_0958 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hac_0958 (atoB)
   00310 Lysine degradation
    Hac_0958 (atoB)
   00380 Tryptophan metabolism
    Hac_0958 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hac_0958 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hac_0958 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Hac_0958 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hac04147]
    Hac_0958 (atoB)
Enzymes [BR:hac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hac_0958 (atoB)
Exosome [BR:hac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hac_0958 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAJ99731
UniProt: Q17X95
Position
complement(838048..839223)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKNVSVRQMGVSVLKDALKASGLDPNDVDSVILGNVLSAG
LGQNIARQIQLDASIPNDRHAFSVNMVCGSSLKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMVYDGLWDAFNDYHMGITADNIAKAYHISREEQDAFAL
QSQLKARVAINAGKFQEEITPIEIVNKKGTIVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASVVILCSAKKVQKLGLKVMAVIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMHLDDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGIGCASLCVGGGQGISVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtagcggcaaagcgtagcgctgtagggagttttttaggctct
ttgaaaaatgtgagcgttaggcaaatgggtgttagcgtgcttaaagacgctttaaaggcg
agcggacttgatcctaacgatgtagattcagttattttaggcaatgtcttatccgctggt
ttgggtcaaaatatcgctaggcaaatccaactggatgcaagcatacctaatgacaggcat
gcttttagcgttaatatggtttgtgggtcgtccttgaaagccattcagttagcacatgat
agcatcatgcttgggcgcgatgaagtggtggtgtgcggtggcgtggagaacatgagtgca
gcaccttatttgtcgtttgacatgcgagagggaaaaagaatggggaatgcgaacatgata
gattctatggtttatgacggactatgggatgcgttcaatgattaccacatggggatcacc
gcagacaatatcgctaaagcataccacataagccgagaagaacaagacgcatttgcactc
caatcgcaactcaaagcaagagttgctatcaatgcagggaaattccaagaagaaatcact
cccattgaaatagtaaataaaaaaggcacgattgttttcaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacctgcctttaaaaaagacggatcggta
acggcagggaattcatcaggaatcaatgatggtgctagcgtagtgattttatgcagtgct
aaaaaagtgcaaaagctagggttaaaagtaatggcggttatcaaggggtttggtttgggc
ggttgcagtccggacataatgggtatatgcccaagcattgcgattaaaaacaaccttaaa
aatgtcaaaatgcatcttgacgacatcaatctttttgaactcaatgaagcctttgccgct
caaagtatagccgtgttaaaagagcttgaactcaaccccaatatcgtgaatgtgaatggc
ggtgcaatagcgattggccatcctattggggcgagcggtgctaggatattggttaccctt
ttgcatgaaatgaagcgaagtgggcatggtattggttgtgcatcattgtgcgtgggtggt
gggcaaggaatatcagtgattgttgaacaaaaataa

DBGET integrated database retrieval system