KEGG   Helicobacter acinonychis: Hac_1068Help
Entry
Hac_1068          CDS       T00371                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hac  Helicobacter acinonychis
Pathway
hac00040  Pentose and glucuronate interconversions
hac00052  Galactose metabolism
hac00500  Starch and sucrose metabolism
hac00520  Amino sugar and nucleotide sugar metabolism
hac01100  Metabolic pathways
hac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hac_1068 (galU)
   00052 Galactose metabolism
    Hac_1068 (galU)
   00500 Starch and sucrose metabolism
    Hac_1068 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Hac_1068 (galU)
Enzymes [BR:hac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hac_1068 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 ECH_2 P53_C
Motif
Other DBs
NCBI-ProteinID: CAJ99832
UniProt: Q17WZ4
Position
complement(924474..925295)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLMQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKEKALQSVRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCTSHNHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIKGELLEE
GVYEIKDMVEKPSQQDAPSNLAVIGRYILTPDIFEILHETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEATNAYYKERL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgccggctatggcacacgctttttgccgatcact
aaaaccatccctaaagagatgctacccattgtggataaacctctcatgcaatacgctgtg
gaggaagcgatggaggcaggctgtgaagtgatggcgattgtgacaggaagaaacaaacgc
agtttggaagattattttgacacgagctatgaaatagagcaccagatccaaggcaccaac
aaagaaaaagcgttgcaaagcgttcgtaacattatagaaaaatgctgtttttcctatgtg
cgccagaaacaaatgaaaggtttggggcatgcgattttaaccggagaagcccttataggc
aatgaaccttttgcagtgattttagccgatgatttatgcactagccacaaccacccaagc
gtgttgaagcaaatgacttcactgtatcaaaaataccaatgctctatcgtggctattgaa
gaagtggcgttagaagaagtttcaaaatacggcgtgattaagggcgaattgttagaagag
ggggtatatgaaattaaagacatggtggaaaaaccaagccaacaagacgccccaagcaat
ttagccgtgatagggcgctatattttaaccccggatatttttgagattttgcacgagact
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttgctcactcaagccaaaaga
aaacgcatcatcgcttaccagttcaaaggcaaacgatacgattgcgggagtgtggaaggc
tatattgaagcgacaaatgcctattataaagaacgcttataa

DBGET integrated database retrieval system