KEGG   Helicobacter acinonychis: Hac_1140Help
Entry
Hac_1140          CDS       T00371                                 

Gene name
folK
Definition
(GenBank) 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokin ase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hac  Helicobacter acinonychis
Pathway
hac00790  Folate biosynthesis
hac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hac_1140 (folK)
Enzymes [BR:hac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Hac_1140 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: CAJ99901
UniProt: Q17WS5
Position
complement(989752..990243)
Genome map
AA seq 163 aa AA seqDB search
MMQEILTSHFFPSLFKRRLDFSNRVVLGLGSNIKNPLKILKNCFLYFKNHSKIGKIFSSP
IYVNPPFGYVKQPDFYNATIILRTCLDLREFFALVFYIERRFGRARKRDFKNAPRTLDID
IIAFNQVILRQNDLTLPHPKWNERDSVLVPLTLQQMLFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcaagagatccttactagccactttttccctagcctttttaaaagaagacttgat
ttttctaacagagtggttttagggttgggatctaatattaaaaatcctttaaaaatatta
aaaaattgttttttatattttaaaaatcatagtaaaattggaaagattttttcctcgccc
atttatgtgaatccgccctttggctatgttaagcaacctgatttttataacgctacgatt
atccttaggacatgtttagatttacgagagttttttgctttggttttttatatagagagg
cgttttggtcgtgcaaggaagcgcgattttaaaaacgctccaagaactttagatattgat
attatcgctttcaatcaagtcattttaagacaaaatgatttgactttacctcatcctaaa
tggaatgaaagggattcggtgttagtgcctttaactttgcaacaaatgctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system