KEGG   Helicobacter acinonychis: Hac_1479Help
Entry
Hac_1479          CDS       T00371                                 

Gene name
thrC
Definition
(GenBank) (Q9ZMX5) Threonine synthase (EC 4.2.3.1); High confidence in function and specificity
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hac  Helicobacter acinonychis
Pathway
hac00260  Glycine, serine and threonine metabolism
hac00750  Vitamin B6 metabolism
hac01100  Metabolic pathways
hac01110  Biosynthesis of secondary metabolites
hac01120  Microbial metabolism in diverse environments
hac01230  Biosynthesis of amino acids
Module
hac_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hac_1479 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hac_1479 (thrC)
Enzymes [BR:hac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hac_1479 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAK00203
UniProt: Q17VX3
Position
1288291..1289763
Genome map
AA seq 490 aa AA seqDB search
MMQGRKMPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFEKLEWQDCLNLSYSELVE
CVFERLGLEVSKDLLTNALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQ
PLASLFSDLAVGKNEKYLMLVSTSGDTGPATLESVANMPNVFVVCLYPKDGTSLVQKLQM
VTQNASNLKVFGISGDFDDAQNTLKNLLKDDDFNEALKTRQLKLSVANSVNFGRIAFQVV
YHIWGFLELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLR
EFIETGRYDLTKRSLKQTFSPAMDILKSSNVERLLFDLFGFERTLELMQALEEEKFYELK
PKELALLQEHFSCASCLDEDCLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSSTA
SYEKFPSTTLLALNEQKKDDKTALEALKNNYNTPDSKRLDDLFEREIKHQEVLKLNEIKS
SILLWLENTH
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaggaagaaaaatgccttttgtccccacgcgctctttgaaagaaaaaaagatt
gattttattgaagcgatacttaaccctaacgcccccaaaggcgggctttacactttagaa
cattttgaaaaattagaatggcaagattgtttgaacctaagctatagtgagctggtagaa
tgcgtgtttgagcgattaggattagaagtttctaaagatttattaaccaacgctttaaaa
cgctatgaaaattttgataaccctaaaaatccagcccccatttttgcactcaatgaaagg
ctttttgtccaagagctctaccatggacctagcttagcgtttaaagacatggcgttacag
cctttagcgagcttgttttctgatctagcggtaggaaaaaatgaaaagtatttaatgctt
gtttctacaagtggggataccggtcctgcgactttagaaagtgtggcgaacatgcctaat
gtttttgtggtgtgtttataccccaaagacggcacaagtttagtccaaaaactccaaatg
gttacccaaaacgctagcaatttaaaagtgtttgggatcagtggggattttgatgatgcg
caaaacacgctcaaaaaccttttaaaagacgatgattttaacgaagccctaaaaacgcgc
caattaaaattaagcgtggctaattccgtgaattttgggcgcatcgcttttcaagttgtc
tatcatatttggggctttttagaattgtataaaaaaggtgcaatcaattctaaagaaaaa
atcaccctagccatacctagcggtaattttgggaacgcattaggggcgttttatgctaaa
aaaatgggcttaaatatcgctaaaatcaaggttgtaaccaatagcaatgatgttttaagg
gagtttatagaaacaggtcgttacgatttaaccaagcgctcattgaaacaaactttctcc
ccagctatggatattttaaaaagctccaatgtggaaagattactttttgatcttttcggg
tttgaacgcacattggaattgatgcaagctttagaagaggagaaattttatgaattaaag
cctaaagaattagcccttttacaagagcatttttcttgcgcgagctgtttagatgaagat
tgcttgaaaaccattcaagaagtttatgcagagcaccaatacttgattgacccccacacc
gccaccgctttaaacgcaagcttaaaaaccaatgaaaaaacccttgtttcttccaccgct
tcttatgaaaaattccctagcaccacccttttagccctaaacgagcaaaaaaaagacgat
aaaaccgccctagaagcgttaaaaaacaactacaataccccagatagcaaacgccttgat
gatttgtttgaaagagagatcaagcaccaagaagttttaaaactcaatgagatcaaatct
tctatccttttgtggctagaaaacacgcattaa

DBGET integrated database retrieval system