KEGG   Helicobacter acinonychis: Hac_1751Help
Entry
Hac_1751          CDS       T00371                                 

Gene name
pit
Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hac  Helicobacter acinonychis
Brite
KEGG Orthology (KO) [BR:hac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Hac_1751 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RnlB_antitoxin EVC2_like
Motif
Other DBs
NCBI-ProteinID: CAK00447
UniProt: Q17V79
Position
complement(1526322..1527923)
Genome map
AA seq 533 aa AA seqDB search
MEIKNIKEFEKASKKLQKDTLKIAFALLFLIVAALLALIFGQTNSRSLLLMFAAVIGGYM
AMNIGANDVCNNVGPAVGSKAISMGGAILIAGVCEMLGAVIAGGEVVSTIKGRIVLPELI
ADAHIFIKVMLASLLSGALWLHVATLIGAPVSTSHSVVGGVIGAGIAAAGASVVNWSFLL
GIVASWVVSPLMGALIAMFFLMFIKKTIAYKEDKKSAALKVVPYLVALMILSFSWYLVLK
VFKRLYAVGFEIQLVCGCILALLIFILFKRFALKKALKLENSHESINELFNIPLIFAAAL
LSFAHGANDVANAIGPLAAISQTLGEASGSVKNALSSVPLWIMIIGGAGIALGLSLYGPK
LIKTVGSEITELDKMQAFCIALSAVITVLLASQLGLPVSSTHIVVGAVFGVGFLRERLRE
QSRRRFAKIRDDIVAAHFGGDLEEIEGFLERFDKASLKEKSLMLESLKKSKNTAIALELK
KKEKKSLKKVYKEEVIKRSILKKIVTAWLVTVPISALLGVLLFIVLNFAEKFF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaatatcaaagagtttgaaaaagcttctaaaaaactccaaaaagacact
ttaaaaatcgcttttgcacttttgtttctcattgttgccgctttgctcgctcttattttt
gggcagactaactccaggagcttgttgctcatgtttgcggctgtgattggggggtatatg
gcgatgaatattggcgctaatgatgtgtgcaataatgtcggtcctgccgtaggatctaaa
gccattagcatgggaggagcgattttgatcgctggggtttgtgaaatgcttggggcggtt
atcgctgggggggaagtggtttctaccattaaaggccgtatcgttttgcctgaattgatt
gcagatgcacatattttcattaaagtgatgttggcaagcttactcagtggggcgttgtgg
ttgcatgtagccactttaattggtgcaccagtttctacttcgcattctgtggtagggggg
gtgattggtgctggaatagcggccgctggtgcgtctgtggtcaattggagttttttacta
ggcattgtggctagctgggtggtttcgcctttaatgggggctttgatagccatgtttttt
ttaatgtttatcaaaaagaccatcgcctataaagaagataaaaagagtgcggctttaaaa
gtcgtgccttacttggtggcgttgatgatcttatcgtttagttggtatttagtgttaaaa
gtcttcaaacgcctctacgcggtgggttttgaaatccagcttgtttgtggctgtatcctt
gcacttttaatctttattctttttaaaagatttgcactaaaaaaagccctaaagttagaa
aatagccatgagagcatcaatgagctttttaatatccctttgatttttgctgctgcactt
ttgagctttgcgcatggggctaatgatgtggctaatgcgattggcccgctagcagcgatc
agtcagactttaggggaggcgagcggttctgtaaagaatgctttaagttctgtgccgttg
tggattatgatcatagggggggctgggattgctttaggcttgagcttgtatgggccaaaa
ctcatcaaaacggtgggctctgaaatcacagagttggataaaatgcaagctttttgcatt
gcgctttctgcggttatcaccgtgcttttagcctctcaattgggcttaccggtaagctct
acgcacattgtggtaggggcggtgtttggagtgggctttttaagagagcgcttaagagag
caatcaagaaggcgttttgccaagattagagacgacatcgtagcggcacactttgggggg
gatttagaagaaattgaaggctttttggagcgctttgataaagccagtttgaaagaaaaa
tcgctcatgttagagagcttgaaaaaaagcaagaataccgccattgctttggaattgaaa
aagaaagagaaaaagtcgctcaaaaaagtgtataaagaagaagtgatcaaacgctccatt
ttaaaaaagattgtcaccgcttggcttgtcacggtgcccatttctgcgttattaggagtg
cttctttttatcgtccttaattttgcggaaaaatttttctag

DBGET integrated database retrieval system