KEGG   Helicobacter apodemus: CDV25_01845Help
Entry
CDV25_01845       CDS       T05516                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
had  Helicobacter apodemus
Pathway
had00020  Citrate cycle (TCA cycle)
had00620  Pyruvate metabolism
had01100  Metabolic pathways
had01110  Biosynthesis of secondary metabolites
had01120  Microbial metabolism in diverse environments
had01130  Biosynthesis of antibiotics
had01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:had00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDV25_01845
   00620 Pyruvate metabolism
    CDV25_01845
Enzymes [BR:had01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CDV25_01845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AWI33640
UniProt: A0A2U8FBL8
Position
387342..388700
Genome map
AA seq 452 aa AA seqDB search
MNNSYDVAIIGAGISGSALFYALTHYTNIQRVVLLEKYSEPATLSSSGNNNSQTIHAGDI
ETNYPFEKAKKVARDAELLVSYALFHNLQNKSIFEYQKMAIGVGDEEVEFMKKRHQEFQE
IFPNLEFFTKDTLREIEPNVVKMLDGSDRVEDIVGSGSRKAFCAMNFHAVSNHMIEQSLF
GEHKLICNFKVTDIIEQGDGAYTLKAPGQPPITASFVLVDAGAHSLVLAQNMGYGLDLGC
LPISGSFYFIPGNKLQGKVYTVQNPKLPFAAIHGDPDIIATGKTRLGPTALSLPKLERFK
SGTFLEFLKVSGFGELSTAKIMWDLISDREIRNYILRNFIYEIPSIGRKYFWEEAKKIIP
SIQLHELSYASGFGGIRPQVLDKTQKKLIFGEKKIKSNKGITFNMTPSPGATSCIKNALV
DMLEIVEYLGKEIKMDKIKEELKEESLEWVLE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaataattcatatgatgtagcaatcataggagctggaatttctgggagtgcattattt
tatgctttaacacattatacaaatattcaaagagtggttttattagaaaagtattcagaa
cccgcaacacttagctcaagtggaaataataattctcaaactatccacgcaggagatatc
gaaacaaattacccttttgagaaagctaaaaaagtagcacgagatgcagaacttttagtt
tcttatgcactttttcataatttacaaaataaaagcatttttgaataccaaaaaatggca
attggtgtaggagatgaagaagtagagtttatgaaaaaacgtcatcaagaatttcaagag
atttttccaaatttagagtttttcactaaagataccctaagagaaatagagcctaatgtt
gttaagatgcttgatggaagtgatagagtagaagatattgtaggttctggatcaagaaaa
gctttttgtgcgatgaatttccacgctgtatcaaatcatatgatagaacaaagtcttttt
ggggaacataaactaatttgtaattttaaagttacagatattatcgaacaaggggatggg
gcttatacccttaaagctcccggacaaccccctatcaccgcttcttttgttttagttgat
gcgggtgcacattcattagtcttagctcaaaatatgggatatggattagatttaggctgt
ttgcctatctctggtagcttttattttatacccggtaataaactacaaggaaaagtctat
actgttcaaaaccctaaacttccttttgcagcaatacacggagatccagatattattgct
acaggaaaaacaagattgggtcctactgcactttctttacctaaacttgaacgttttaaa
agtggcactttcttagaatttcttaaagtttctgggtttggggaactctctactgcaaaa
attatgtgggatttaatttctgatagggaaattagaaattacattttacgaaactttatt
tatgaaattccaagtattggacgaaaatatttttgggaagaagcaaaaaagattatcccc
tctattcaacttcatgagttatcttatgcaagtggttttggtggtattagaccccaagtt
cttgataaaacacaaaaaaagctaatctttggtgagaaaaaaattaaaagcaataaaggt
attacttttaatatgactccaagcccgggtgctacaagctgtattaaaaatgctcttgta
gatatgttagagattgtagaataccttggtaaagaaattaaaatggataaaatcaaagaa
gaattaaaagaagagagtttggagtgggtgcttgagtga

DBGET integrated database retrieval system