KEGG   Helicobacter apodemus: CDV25_07480Help
Entry
CDV25_07480       CDS       T05516                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
had  Helicobacter apodemus
Pathway
had00540  Lipopolysaccharide biosynthesis
had01100  Metabolic pathways
Module
had_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:had00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CDV25_07480 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:had01005]
    CDV25_07480 (rfaD)
Enzymes [BR:had01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CDV25_07480 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:had01005]
 Unusual sugar
  CDV25_07480 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 KR Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AWI34621
UniProt: A0A2U8FEC8
Position
complement(1523178..1524176)
Genome map
AA seq 332 aa AA seqDB search
MQYISDTLEGKHILITGGAGFIGSNLALYFQEYHPKAKVVVFDCFRNEETFSNGNLKSLG
HFKNLLGFNGEVIVGDINNKQDLERLEENRFDYIFHQAAISDTTISNQETVLRSNVNAFK
DLLQLCLKTHSKMIYASSAGVYGNTPAPNNIGSGEIPQNIYGFSKLMMDNLASKYAQSFP
FLHIVGLRYFNVYGKNEFYKGKTASMILQLGLQALKSKKVRLFKMGEQKRDFVYIKDVIQ
ANIKAMRAKKSGVYNVGSGEARSYNDIVASLREHLGDFEVEYFDNPYNFFQTHTQANIAL
TKEFLGYESKFSLEDGIKDYVGQIQDIHLKGW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatattagcgataccttagagggaaagcatattttaatcaccggaggagcagga
tttataggttctaatttagcattgtattttcaagaataccaccctaaggctaaagtagtc
gtctttgattgctttagaaatgaagaaacttttagtaatggtaatcttaaatctctaggg
cattttaagaatctcttaggttttaatggtgaagtaattgttggtgatattaacaataaa
caagatttagaacgattagaagaaaataggtttgattatatctttcaccaagcagctatt
tctgatactactattagcaatcaagagactgttttaagaagcaatgtcaatgcctttaaa
gatctattgcaattatgcttaaaaacacattctaagatgatttatgcctcaagtgctggt
gtatatggcaataccccagctcccaataatataggaagcggtgagattccccaaaacatt
tatggattttctaaacttatgatggataatttagcgagtaaatacgcacaaagctttcct
ttcttgcatatcgtaggattacggtattttaatgtctatggcaaaaatgaattttacaaa
ggcaaaaccgcttctatgattttacaattaggcttacaagccttaaaaagtaaaaaagtt
cggctctttaaaatgggggagcaaaaacgcgactttgtctatattaaagatgttattcaa
gctaatattaaagcaatgagggctaaaaaaagcggggtttataatgtaggaagtggagag
gctaggagttataatgatatagtagcctctcttagagagcatttaggggattttgaagtg
gaatattttgataatccctataatttttttcaaacccatacacaagctaatattgcactc
actaaagaatttctaggctatgagtctaaattctccttagaggatggcattaaagactat
gtagggcaaatccaagatattcatctaaagggctggtaa

DBGET integrated database retrieval system