KEGG   Helicobacter apodemus: CDV25_09880Help
Entry
CDV25_09880       CDS       T05516                                 

Definition
(GenBank) conjugal transfer protein TraJ
  KO
K03203  type IV secretion system protein VirB8
Organism
had  Helicobacter apodemus
Pathway
had03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:had00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CDV25_09880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:had02044]
    CDV25_09880
Secretion system [BR:had02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   CDV25_09880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8 Uso1_p115_head
Motif
Other DBs
NCBI-ProteinID: AWI35135
UniProt: A0A2U8FHT7
Position
unnamed:2530..3201
Genome map
AA seq 223 aa AA seqDB search
MKENKFNTNLALDYEASFRYLIEKSNQRAWIITFISIFITILSIIAVVLLTPLKTIEPYV
IRVDNTTGMVDILTILDEKEITKNEALDKYFISTYVKAREGYYYELLNQDYLLTQLMSSE
KVANEYRSWYEGENARDQILKNSNEVNVQILSIVLGESNGVKTSTIRAMIITKNLNTKAT
SQATKVITLSYDYLLARASEENRMLNPLGFKVLTYRVDEEVVR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaataaattcaatacaaatcttgctttagattatgaagcaagttttagatat
ttaatagaaaaaagcaaccaaagagcttggatcattacttttattagtatttttatcaca
atcctttctattattgctgttgtcttgctcactcctttgaaaaccatagagccttatgta
ataagagtagataataccacagggatggtagatattttaaccatacttgatgaaaaagaa
atcacaaaaaatgaagccttagataaatattttatcagcacctatgttaaggctagagaa
ggctattactatgagcttttaaatcaagattatcttcttactcaattaatgagttctgaa
aaagttgctaatgaatatagaagttggtatgaaggcgaaaatgcgagggatcaaatctta
aaaaattccaatgaagtaaacgttcaaattctaagtattgttttaggagagagcaatggg
gttaaaacttcaaccataagggcaatgattataacaaaaaatctaaatactaaagcaaca
tcacaagccacaaaagtaatcactctaagctatgactatcttttagcaagagcaagtgaa
gaaaatagaatgctaaatccattgggattcaaagttttaacttatagggttgatgaagag
gtggtaagatga

DBGET integrated database retrieval system