KEGG   Halohasta litchfieldiae: halTADL_2858Help
Entry
halTADL_2858      CDS       T05239                                 

Definition
(GenBank) PiT family inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hae  Halohasta litchfieldiae
Brite
KEGG Orthology (KO) [BR:hae00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    halTADL_2858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ATW89566
UniProt: A0A1H6WZI9
Position
2770846..2772012
Genome map
AA seq 388 aa AA seqDB search
MIEFWLPFGAALLASAFMAWAIGAGSSGATPFAPAVGANAISVMRAAFIVGILGFLGAAL
QGASVSEAVGSDLVVGLTLPTAAVIVVLVTAAGLMAIGIVTGYPIATAFTVTGTVIGAGL
ALGGDPAWAKYTEIGTMWLLTPFVGSGVAYGIASILPRESVDERDSVPILAAAVGAIVVN
IEFALLASGDRLASLSTVVAERFVPGLAGELGVSLVAAVVVGLAVRVDIARNGLGGLRRF
LLVLGGLVAFSAGASQVGLAVGPLVPLVEETMITVSALAAGGGVGLLVGSWTGASQMIKA
VSQDYASLGPRRSIAALFPSFVLAQIAVLYGIPVSFNQIMVSAIVGAGAAVGGSDAISRR
KIGLTFGAWIGSFALAFALGYGVMSLVP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagttctggctgccgttcggggctgccctgctggccagcgcgttcatggcgtgg
gcgatcggtgcgggatcgagcggggcgacaccattcgcccccgcggtcggtgcgaacgcc
atctcggtgatgcgggcggcgttcatcgtcggaattctcggctttttgggagccgccctc
cagggagcgagcgtctccgaggctgtcggcagcgacctcgtcgtcgggcttaccctgccg
accgccgcggtgatcgtggtgctggtgaccgccgccgggctgatggcgatcggcatcgtt
actggatatccgattgcgaccgccttcaccgtcaccgggacggttatcggtgcggggctc
gcgctcggcggcgatcccgcgtgggcgaagtacaccgagatcggaacgatgtggctcttg
acgccctttgtcggtagtggcgtcgcctacgggatcgccagcatcttgccccgagaatca
gtcgacgaacgcgatagcgtcccgatccttgccgcggctgtcggcgcgatcgtcgtcaac
atcgaattcgcgctgctcgcctcgggcgaccggttggcctcactgtcgaccgtcgtcgcc
gagcgattcgttcccggtctcgcgggcgaactcggcgtctcgcttgtcgccgcggttgtc
gtcggactggctgtccgggtcgacatcgctcggaacggattgggcggcctccggcgcttt
ttgctcgttctcggcgggctggtcgccttctcggcgggcgcgagtcaggtcgggctggcg
gtcgggccgctagtaccgctggtcgaggagacgatgatcaccgtctcggcgctggcggcc
ggcggcggcgtgggcctgctggtcggctcctggaccggggcctctcagatgatcaaggcc
gtctcacaggactacgcttcgctgggcccgcggcggtcgatcgccgcgctgttcccctcg
ttcgtgctcgcccagatcgctgtcctctacgggattccggtctcgttcaaccagatcatg
gtcagcgcgatcgtcggcgcaggtgcggccgtcgggggaagcgacgcgatcagtcgacgg
aaaataggcctgactttcggcgcgtggatcggctcgttcgccctcgcgttcgccttgggt
tacggcgtgatgagcctcgtaccgtaa

DBGET integrated database retrieval system