KEGG   Halohasta litchfieldiae: halTADL_3174Help
Entry
halTADL_3174      CDS       T05239                                 

Definition
(GenBank) PiT family inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hae  Halohasta litchfieldiae
Brite
KEGG Orthology (KO) [BR:hae00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    halTADL_3174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ATW89876
UniProt: A0A1H6SU84
Position
3064700..3065896
Genome map
AA seq 398 aa AA seqDB search
MVATGTLLTFGVAAAASLFMAWAIGAGSSGSTPFAPAVGANAISVMRAGLIVGVLGFFGA
VFQGANVTEAVGSELIIGEPLTATAAIVGLITAAVLVAIGVFAGYPIATAFTVTGAIVGV
GLAMGGAPAWAKYAEIMTLWVLTPFVGGGIAYGIARLLRGDRFDEDYLIALLGGVIGFII
ANVGFAFLGPPDGSGSIAGTLGAGLPLPTVAGVDGGQIVAALAVAALSVAVLWFALNRDR
TAGQRRFLLVLGGLVAFSAGGSQVGLAIGPLVPLLGSGIEIPLWAVLTGGGFGLLLGSWT
GAPRMIKALAQDYSALGPRRSIAALIPSFAIAQTAVAFGIPVSFNEIIVSAIVGSGYAAG
NAGVSRRKMIYTVLAWVGSLVLSFVLAYGIFTLITLVR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggtagcaactggcacactactcacgttcggcgttgcggccgccgccagcctgtttatg
gcgtgggccatcggggccggctcctcgggctctacgccgttcgcccccgcggtcggtgcc
aacgcgatctccgtcatgcgggccgggctgatcgtcggcgtcctcggcttctttggagcc
gtctttcagggcgcgaacgtcaccgaagcagtcggcagcgaactcatcatcggtgagcca
ctcaccgcgaccgcggcgattgtcgggctcatcaccgccgccgtgttggtcgctatcggc
gtcttcgctggctacccgattgcgaccgcctttacggtcactggcgctatcgtcggcgtc
ggattggcgatgggcggcgcgcccgcgtgggcgaagtatgccgagatcatgacgctgtgg
gtgctgacgccgtttgttggcggcggcatcgcctacggcatcgctcgcctcctccggggc
gaccggttcgacgaggattatctgatcgcgctgttgggtggcgttatcggctttatcatc
gctaacgtcggcttcgcattcctcggcccaccagatggctccggttcgattgccgggacg
ctcggtgcagggttgccgcttcccacggtggctggcgtcgacggcggccagatagtcgcc
gcactcgccgtggcggcgctgtcagttgcggtgctttggttcgcgctcaaccgggaccgg
acggccggccagcggcggttcctgctcgtgctcggtgggctcgtggcgttctcggccggc
ggcagtcaggtcgggctggcgattggcccgctggtgccgttgctgggtagcggtatcgag
atcccactgtgggctgttcttaccggcggtgggttcggactcctgcttggctcgtggacc
ggcgcgccgcgaatgatcaaagcactggcccaagactactccgcgctcggcccccggcgc
tcaatcgcggcgctcatcccctcgttcgctatcgcccagacggcggtcgcgttcgggatt
ccggtctcgtttaacgagatcatcgtcagcgccattgttggcagcggctacgccgcgggg
aacgccggggtgagtcgacggaaaatgatctacaccgtgctcgcatgggtcggctcgctc
gtgttgtcgttcgtgttggcctacgggatcttcacgctgattacactcgttcggtga

DBGET integrated database retrieval system