KEGG   Halohasta litchfieldiae: halTADL_3319Help
Entry
halTADL_3319      CDS       T05239                                 

Definition
(GenBank) precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
hae  Halohasta litchfieldiae
Pathway
hae00860  Porphyrin and chlorophyll metabolism
hae01100  Metabolic pathways
hae01110  Biosynthesis of secondary metabolites
hae01120  Microbial metabolism in diverse environments
Module
hae_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    halTADL_3319
Enzymes [BR:hae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     halTADL_3319
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     halTADL_3319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Abhydrolase_6 PcrB
Motif
Other DBs
NCBI-ProteinID: ATW90021
UniProt: A0A1H6WAW7
Position
3197226..3197900
Genome map
AA seq 224 aa AA seqDB search
MIPLYHDFSEETVLVFGGGSVGARKARRFAREAQVVVISPAFDERFETDEELAAVDRIRA
APEPAEVPEWVDRFEPVLVVAATDDPDLNRAVDEAASERGLLINRTDQSGGRDVDSVVVP
ATVRDGPVSVAISTGGKSPALSRYLRQQIEAEIEDAGAMAELTGELRAELKESDLSVADR
RAAVRSVVRSSSVWKALHTGTAKATKEAERVMAAEHDDTDGGSR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgataccgctctaccacgatttcagcgaggaaacggttctcgtcttcggcggcggcagc
gtcggagcccgcaaggctcgccggtttgcccgcgaggcgcaggtggtcgtcatcagcccg
gcgttcgacgagcgatttgagaccgacgaagagctggcagctgtcgaccgaatccgtgcg
gctccggagccagccgaggtcccggagtgggtcgaccgattcgagcctgtcttggtcgtt
gctgcaaccgacgaccctgatttaaatagggcagtcgacgaggcagccagcgaacgtgga
ctacttataaaccgtaccgaccagtccggcggacgggatgtcgacagcgtcgtcgttccg
gccaccgtgcgcgatgggccggtatcggttgcgatttcgaccggcgggaagagtcccgca
ctctcgcgatatttgcgccagcagatcgaagccgaaatcgaggatgcgggtgcgatggcc
gagcttacgggggagcttcgagcggagctgaaagaatccgacctctcggtggcagatcgc
cgggcggctgtccggtcggttgtccgttcgtcgtccgtttggaaggctttacatacgggt
actgccaaagcgacaaaagaggcagagcgcgtaatggcagccgaacacgacgacacggac
ggtggaagccgatga

DBGET integrated database retrieval system