KEGG   Halomonas sp. SF2003: C8233_02510Help
Entry
C8233_02510       CDS       T05423                                 

Definition
(GenBank) ADP-ribose pyrophosphatase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
haf  Halomonas sp. SF2003
Pathway
haf00760  Nicotinate and nicotinamide metabolism
haf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    C8233_02510
Enzymes [BR:haf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     C8233_02510
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     C8233_02510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like FAD_syn
Motif
Other DBs
NCBI-ProteinID: AVV32698
UniProt: A0A2R4ITJ3
Position
613978..615132
Genome map
AA seq 384 aa AA seqDB search
MPSTTTLPSAPAATLRTQDSPAIADTQYDCLVFIGRFQPMHHGHVAVMEEALRLARQVIV
LVGSAWQARSLRNPFTFSERTRMIRSCFDDADNARLEIVPLLDALYNDDVWVRDVQRKVR
DIARPQANRMPRIALIGANRRDSNSQSSYYLSLFPQWESVAVPLREGMEASRIREVIFTE
RARAEDWLDNEGLELLPPPVAQHLHGFLDETAWQGLVEERRLLEQYRAAWSDAPYPPLFI
TVNAVVVQSGHVLLTTRRAAPGKGLYALPGGFVQPQERLLDACLRELKERVRLKVPEPVL
RGSLRGQRLFDAPHRSWRGRTLAEAFYFALRPEQQLPKLRSGGGENEEQARWVALADLEP
DTLFEDHFFIIQNFLGLHAGQSSF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgacaacaacgttgccctctgcacccgctgcaacgcttcgcactcaggattct
cccgcgatcgccgacacccagtacgactgtctagtcttcatcggtcgcttccaacccatg
caccatggccatgttgccgtgatggaagaagccttgcgcctcgcgcggcaggtcatagtg
ctggtcggttctgcctggcaggcacgttcactgcgcaacccgttcaccttctctgaacgc
acgcgcatgatccgcagttgctttgacgatgccgacaatgcgcgcctggaaatcgtgccg
ttgctagacgccctctacaacgacgatgtctgggtacgtgatgtgcagcgcaaggtacgc
gatatcgcgcgtccgcaggccaaccgaatgccgagaatcgcactgatcggtgccaatcgt
cgtgacagcaacagccagtcaagctactacctgagcctcttcccgcagtgggagtcagtg
gcggtgccactgcgcgaggggatggaggccagccgtattcgtgaggtcatcttcaccgag
cgcgcccgcgccgaggattggctggacaacgagggactggagctgctgccaccgccggtg
gctcagcacctgcatggcttcctggatgagactgcgtggcaagggctggtcgaggaacgt
cgcctgctggagcaatatcgcgccgcctggagcgatgcgccctacccgccactgttcatt
acggtcaacgccgtggtggtgcagtctggtcatgtgctgctcaccacacgtcgcgcggca
cccggcaaggggctttacgccctgcctggcggcttcgtgcaaccccaggagcgcctgctg
gatgcctgcctgcgtgagctcaaggagcgtgtgcgcctcaaggtgccggaacctgtgcta
cgtggctctctgcgcggacagcgtctgtttgacgcgccgcatcgcagctggcgcggacgc
accctggcagaggccttctacttcgccctgcgaccggagcagcagctccccaaactcaga
agcggcggcggcgagaacgaggagcaggcacgctgggtcgcgctggcggatctggagcct
gacaccctcttcgaggaccacttcttcatcattcagaatttcctcggcctgcatgcaggc
caaagcagtttctga

DBGET integrated database retrieval system