KEGG   Halomonas sp. SF2003: C8233_03560Help
Entry
C8233_03560       CDS       T05423                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
haf  Halomonas sp. SF2003
Pathway
haf00970  Aminoacyl-tRNA biosynthesis
haf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C8233_03560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:haf03029]
    C8233_03560
Enzymes [BR:haf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C8233_03560
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C8233_03560
Mitochondrial biogenesis [BR:haf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C8233_03560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AVV32870
UniProt: A0A2R4IU19
Position
885425..886816
Genome map
AA seq 463 aa AA seqDB search
MSDENKRLEQAREFWARPPRQRTLMQLLETYQTGSFGPEQTATVLAERHQALGESASHSI
ISRDDAGMSVQAAAQQQLKAAATSLPLGGVPVSIKDLFDETGMTTLAGSRALAGSQPADQ
DAVALSRLKAAGILHAGRTSMSEFAFSGLGLNPHVGTPPNPFDGERITGGSTSGGAASVA
FGLAAATLGSDTGGSLRIPAAFCGLTGFKPSQASVPGDGAFPLSPSLDCIGPIAPSVACC
RRLWEVLSDEVADPTPLTRPLTLLVPESELVSEVDADVAADFAALLERLEGLGVRLQRAP
VEAIEAAYAINQRGGLVIPEAAAVHHELLAAHEAQYDPLIAERLNGGRDITSSEYLARLW
PRTAIQQRFAQQVQDVDAVLMPTVAMRAPRRDLLEQDGALFAQLNKRALRNTSVFNYLDA
SSISIPAPAPQNEEPLGLMLSRPQGQDVALLRVAQALETLLAQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgagaacaagcgccttgagcaggcgcgtgaattctgggcgcgcccgccccgc
cagcgcacgttgatgcagttgctagagacctatcaaacaggcagtttcggccccgagcag
accgccacggtgcttgccgagcgccatcaggccctgggcgagagtgccagccacagcatc
atcagccgcgatgatgctggcatgagcgtgcaggccgccgctcagcagcaactcaaggcg
gcggcgacgtcgttgccgctggggggtgttccggtctcgatcaaggacctcttcgacgag
accggcatgacgacgctggcgggctcgcgggcactggcaggaagccaaccagccgatcag
gacgctgtggcgctgagccggctgaaagccgccggtatcctgcatgccggccgcaccagc
atgagtgaattcgcgttctctggcctgggcctgaacccgcatgtcggcacgccgcccaac
cccttcgacggcgagcggatcaccggcggctcgacctccggcggtgccgcctccgtcgcc
ttcgggctggcagccgcgaccctgggcagcgataccggcggctcgctgcggattccggcg
gccttctgtggcctgacgggcttcaagccgtcacaggccagcgtgccgggagatggcgcc
ttcccgctgtcaccgagcctggactgcatcggccccatcgcgcccagcgtcgcctgctgt
cgccgcctgtgggaagtcctgagcgatgaggtcgctgacccgacgccactcacccgcccg
ctgacgctgctggtgccggagagcgagctggtcagtgaagtggacgctgatgtggccgcc
gacttcgccgccctgctggaacggctcgaagggctgggggttcgcctccagcgtgcgccg
gtcgaggccatcgaggccgcttacgccatcaatcagcgcggcgggctggtcattccggaa
gcggccgccgtacatcacgaactgctggccgcccacgaagcccagtatgatccgctgatc
gccgaacgcctgaacggcgggcgcgacatcacctccagcgagtatctggcgcgcctgtgg
ccgcgtaccgccatccagcaacgcttcgctcagcaggtgcaagatgtcgatgcggtgctg
atgccgaccgttgccatgcgtgccccgcgtcgtgacctgctggagcaggatggcgcgctc
ttcgcccagctcaacaagcgcgcgctgcgcaacaccagcgtcttcaactacctggatgcc
agctcgatctcgattccggcgccggcaccacagaacgaagaaccgctgggcctgatgctg
tcgcgccctcagggtcaggatgtggcgctgctgcgcgtcgcccaggcgctggagacactg
ctcgcgcaatag

DBGET integrated database retrieval system