KEGG   Halomonas sp. SF2003: C8233_04445Help
Entry
C8233_04445       CDS       T05423                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
haf  Halomonas sp. SF2003
Pathway
haf00620  Pyruvate metabolism
haf00630  Glyoxylate and dicarboxylate metabolism
haf01100  Metabolic pathways
haf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:haf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C8233_04445
   00630 Glyoxylate and dicarboxylate metabolism
    C8233_04445
Enzymes [BR:haf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     C8233_04445
    1.2.1.22  lactaldehyde dehydrogenase
     C8233_04445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487 PSK_trans_fac
Motif
Other DBs
NCBI-ProteinID: AVV33030
UniProt: A0A2R4IUJ5
Position
1102107..1103531
Genome map
AA seq 474 aa AA seqDB search
MRTDKNFINNEFVASSQGEMISVYNPATEALVGQVQAATTDEALEAVSIAAKAQKDWRAK
TSTERAGYMHKLAEALMARKDAIGQALADESGKSLEDATNEAVYAADITRYHAEWARRIE
GEIVPSDTPNESLLLQREPIGVVACLIPFNYPVFTLLRKIAPALITGNAVVVRPSNNTPT
SAFEIAKAIQDAGIPAGIVNILAMDHGTAEAVCTHPKVGMITLTGSVGAGRKVLEYSQVN
IAKSSLELGGKSPAIVEPDADLAKAAAQIAASTLTNCGQLCTAIERVYVHESVYDDFVAQ
LKQQMEGVKFGNRLEDASLMGPLINENSRLNIHQMVERAIDDGATLEIGGYIPEGKGHFY
PPTLLTGCRQDMEIVQEEIFGPVLPVLTYSDVDEALALANDHQFGLASVVFTENYRTAMK
VANNIEAGELYINRTPADPYQGYHAGWKRSGLGGDDGKHGMLDYTQTRLVVMNY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactgacaagaacttcatcaacaacgaattcgtcgcctcatcccagggcgagatg
atttcggtctacaacccggccaccgaagcactggtaggtcaggtgcaggcagcaaccact
gacgaagcgcttgaagcggtgagcattgcggccaaggcgcagaaggactggcgtgccaag
accagcaccgagcgtgccggctacatgcacaagcttgccgaggcgctgatggcgcgcaag
gatgccatcggccaggcattggcagatgagtccggcaagagtctggaagacgccaccaat
gaagccgtctacgccgccgacatcacgcgctaccacgccgagtgggcacgtcgtatcgag
ggcgagatcgttcccagcgacactcccaatgaaagcctgctgctgcagcgcgagcccatc
ggcgtcgtggcctgcctgattccgttcaactacccggtgttcaccctgctgcgcaagatc
gccccggcgctgatcaccggcaatgccgtggtcgtgcgtccgagcaacaacaccccgacc
tccgccttcgagatcgccaaggcgatccaggatgccggcattccggcaggcatcgtcaac
atcctggcgatggaccacggcaccgcagaagccgtctgcacgcaccccaaggtgggcatg
atcaccctgaccggcagcgtcggcgccggtcgcaaggtgctggaatattcccaggtcaac
atcgccaagtcctcgctggagctgggcggaaagtcaccggccatcgtcgagccggatgcc
gacctggccaaggcagcggcacagatcgcggcctctaccctcaccaactgtggccagcta
tgtaccgccatcgagcgtgtctatgtgcacgaatccgtctatgacgatttcgtcgcccag
ctgaagcagcagatggaaggcgtcaagttcggcaaccgtctggaagatgccagcctgatg
gggccgctgatcaacgagaattcgcgtctcaacatccatcagatggtggaacgcgccatc
gatgacggcgccactctggaaatcggcggctacatccccgaaggcaagggtcacttctac
ccgccgaccctgctgaccggttgccgtcaggacatggagatcgtgcaggaagagatcttc
ggcccggtactgccggtgctgacctacagcgatgtggatgaagcgttggcactggccaat
gaccaccagttcggtctggcctccgtggtcttcaccgagaactatcgcaccgccatgaag
gtcgccaacaacatcgaagccggcgagctctacatcaaccgcaccccggcggacccctac
cagggctaccacgccggctggaagcgttctggcctgggcggtgatgatggcaagcacggc
atgctcgactacacccagacccgtctggtcgtgatgaactactga

DBGET integrated database retrieval system