KEGG   Halomonas sp. SF2003: C8233_09610Help
Entry
C8233_09610       CDS       T05423                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
haf  Halomonas sp. SF2003
Pathway
haf00260  Glycine, serine and threonine metabolism
haf01100  Metabolic pathways
haf01110  Biosynthesis of secondary metabolites
haf01120  Microbial metabolism in diverse environments
haf01130  Biosynthesis of antibiotics
haf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:haf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C8233_09610
Enzymes [BR:haf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C8233_09610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AVV33882
Position
complement(2355565..2356650)
Genome map
AA seq 361 aa AA seqDB search
MTTDAIAPTPAATSAADEACTSRFLASDNTSGICPEAMAYMMQANRDDDLAYGNDRWTQQ
VTDSFRQLFETECEVFFVFNGTAANSLSLAHLCQSYHSVICHELAHIETDECGGPEFFSN
GSKLLNAPGPDGKLTPEGIEQLVTKRSDIHYPRPRVISLTQCTEVGTVYSLEELQAIREV
ADRHDLQIHMDGARFANACAALNVSPAELTWKAGVDVLCFSGTKNGLAMGEAVIFFDRKL
ARDFDYRCKQAGQLASKMRFIAAPWMGLLENDVWLNNARHANGMAQYLAERLEALEGIET
LFPSEANSVFASFPEHVLAALRERGWTFYTFIGAGGARFVCSWNTTTELLDALLKDIRDV
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgacgccattgccccgacccccgctgcgacctctgctgccgatgaagcgtgc
acttcacgctttctggccagtgacaacacgtccggtatctgtcccgaggcgatggcgtac
atgatgcaggccaatcgtgatgacgatctcgcctacggcaatgaccgctggacacagcag
gtcaccgacagcttccgtcagttgttcgagaccgagtgcgaggtgttcttcgtcttcaat
ggcaccgccgccaactccctgtcgctggcccacctgtgccagtcctaccacagtgtcatc
tgccacgaactggcccatatcgagaccgatgaatgcggtgggccggagttcttctccaac
gggtccaagttgctcaacgcgccgggccccgacggcaagctgacgccggaaggcatcgag
cagctggttactaagcgcagtgatatccactatccgcgtccgcgcgtgatctccctgacc
cagtgcaccgaggtcggcaccgtctacagcctggaagagctgcaggcgattcgtgaagtg
gctgaccgtcatgatctgcagatccatatggatggcgcccgtttcgccaatgcctgcgcc
gcgctgaatgtctcaccggctgagctgacctggaaggcgggcgtggacgtgctgtgcttc
tccggcaccaagaatggcctggccatgggggaggcggtgatcttcttcgatcgcaagctg
gcacgcgatttcgattaccgctgcaagcaggccggtcagctggcctccaagatgcgcttc
atcgcggcgccctggatggggctgctggaaaatgatgtctggctgaacaacgcccgccat
gcgaacggcatggcacagtatctggccgagcgtctcgaggcgctggagggcatcgagacg
ctgttccccagcgaggccaacagcgtgttcgccagcttccccgagcatgtgctggcggca
ctgcgtgagcgtggctggaccttctataccttcatcggtgcgggtggcgcgcggttcgtc
tgctcctggaataccaccaccgagttgctcgacgccttgctcaaggatattcgcgacgtg
ctgtga

DBGET integrated database retrieval system