KEGG   Halomonas sp. SF2003: C8233_09695Help
Entry
C8233_09695       CDS       T05423                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
haf  Halomonas sp. SF2003
Brite
KEGG Orthology (KO) [BR:haf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:haf03016]
    C8233_09695
Enzymes [BR:haf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     C8233_09695
Transfer RNA biogenesis [BR:haf03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    C8233_09695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AVV35505
Position
2371507..2372328
Genome map
AA seq 273 aa AA seqDB search
MTEPVELTEPAEPLDILFQDEVLVVVHKPSGLLVHRSPIDKHETEFLLQRLRDQIGQHVF
PVHRLDRPTSGLMVFGLSPQAARKLSTAFEEQQVSKRYLAIVRGVAPEQQRLDYGLRKED
GKLPKAEMPEQEAITDTRRLAQVELPIAIDRYPQSRFSLVEARPLTGRRHQIRRHLSRRG
YPIIGDAKHGKGNYNRYFATTLECPRLLLAAVGLELPHPEGGWLSLSCPPEGAYAALMER
FGWLGHLPERYAEHLAERPTRHWLDATASDPAD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcctgttgagctgactgaacccgccgaaccactcgacatcctgttccaggat
gaggtgctggtggtggtccacaagccatcgggcctgctggtgcaccgcagccccatcgac
aagcacgagaccgagtttctgcttcagcgcctgcgcgaccagatcggccagcatgtcttc
cccgtgcatcgcctcgatcgccccacatcagggctgatggtgttcggcctctcgccccag
gcggcgcgcaagctgagcaccgccttcgaggagcagcaggtcagcaagcgctatctggcg
atagtgcgtggtgtcgcgcccgagcagcaacgcctcgattacggcctgcgcaaggaagat
ggcaagctgcccaaggccgagatgccggagcaggaagccatcaccgacacgcgccgcctg
gcacaggtcgagctgcccatcgccatcgatcgctatccgcagtcgcgcttctcgctggtc
gaggcccgcccgctgaccggccgccgccatcagattcgccgtcacctgtcacgccgtggc
tacccgatcatcggcgacgccaagcacggcaagggcaactacaatcgctacttcgccacg
acactggaatgcccccgcctgctgctggcggctgtcgggctcgagctccctcaccccgag
ggcggctggctgagcctgtcgtgtccgccagaaggtgcctacgcggcactgatggagcgc
ttcggctggctgggccatctgcccgaacgctacgctgaacatctggcagagcgcccgacc
agacactggctcgatgcgaccgccagcgacccggctgactga

DBGET integrated database retrieval system