KEGG   Halomonas sp. SF2003: C8233_10360Help
Entry
C8233_10360       CDS       T05423                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
haf  Halomonas sp. SF2003
Pathway
haf00071  Fatty acid degradation
haf00072  Synthesis and degradation of ketone bodies
haf00280  Valine, leucine and isoleucine degradation
haf00310  Lysine degradation
haf00362  Benzoate degradation
haf00380  Tryptophan metabolism
haf00620  Pyruvate metabolism
haf00630  Glyoxylate and dicarboxylate metabolism
haf00640  Propanoate metabolism
haf00650  Butanoate metabolism
haf00900  Terpenoid backbone biosynthesis
haf01100  Metabolic pathways
haf01110  Biosynthesis of secondary metabolites
haf01120  Microbial metabolism in diverse environments
haf01130  Biosynthesis of antibiotics
haf01200  Carbon metabolism
haf01212  Fatty acid metabolism
haf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:haf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C8233_10360
   00630 Glyoxylate and dicarboxylate metabolism
    C8233_10360
   00640 Propanoate metabolism
    C8233_10360
   00650 Butanoate metabolism
    C8233_10360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C8233_10360
   00072 Synthesis and degradation of ketone bodies
    C8233_10360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C8233_10360
   00310 Lysine degradation
    C8233_10360
   00380 Tryptophan metabolism
    C8233_10360
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C8233_10360
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C8233_10360
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C8233_10360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:haf04147]
    C8233_10360
Enzymes [BR:haf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C8233_10360
Exosome [BR:haf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C8233_10360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AVV33992
Position
2516319..2517500
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAARRTAVGAFGGSLAGISAADLGAHVIKDILASTGVSGDQVDEVLLGQVLTAG
CGQNPARQAVIKAGLPEGVPAMTINKVCGSGLKALHLATQAIRCGDAELILAGGQENMSL
SPHVLPNSRDGKRMGDWKAIDSMVHDGLWDAFNDIHMGITAENLAEKYEITREAQDAFAA
ASQQKACAAIEAGRFKGQIVPVEIPQRKGDPIVFDTDENPRAGTTAEKLGGMRPAFKKDG
TVTAGNASALNDGAAVVMLCSADKARELGLTPLATIKAYSNAGVDPKIMGIGPAPATRLC
LKKAGWSLEDLDLIEANEAFAAQALSVNKELGWDVDKVNVNGGAIALGHPIGASGCRVLV
SLVHEMIERDAKKGLATLCIGGGQGVALAIERS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgtggtgatcgtagcagcccgtcgtaccgccgtaggcgccttcggtggcagc
ctggctggcatttccgccgcggatctcggcgcacatgtcatcaaggatatcctcgccagc
acgggtgtcagtggcgatcaggtcgatgaagtgcttctgggccaggtactgacagcagga
tgcggtcagaacccggcacgtcaggcggtcatcaaggcaggcttgccggaaggcgtgccc
gccatgaccatcaacaaggtctgcgggtctggcctcaaggcgctgcacctggccacccag
gccatccgttgcggcgatgccgagctgattctggccggcggtcaggaaaacatgtccctg
tctccgcacgtgctgcccaactcgcgtgacggcaagcgcatgggcgactggaaggcgatc
gactccatggtccacgacgggctgtgggatgccttcaatgacatccacatgggcatcacc
gccgagaatctggccgagaaatacgagatcacccgtgaagcccaggacgccttcgcggcc
gcctctcagcagaaggcctgcgcagccatcgaagctggccgcttcaagggccagatcgtc
ccggtcgagatcccgcagcgcaagggcgacccgatcgtcttcgataccgacgagaacccg
cgcgccggcaccacggccgagaagctcggcggcatgcgcccggccttcaagaaggatggc
accgtcaccgccggcaatgcctcggcgctcaacgatggcgctgccgtggtcatgctgtgc
tccgccgacaaggcccgcgagctgggtctgacgccgctagcgaccatcaaggcctactcc
aacgcgggtgttgatccgaagatcatgggcatcggcccggcgccggcgactcgcctgtgc
ctcaagaaggccggctggagcctggaagacctcgacctgatcgaagccaacgaagccttc
gccgcccaggccctgtcggtcaacaaggagctgggctgggatgtcgacaaggtcaacgtc
aatggcggcgccattgccctcggccacccgatcggtgcctccggctgccgtgtgctggtc
tcgctggtacacgagatgatcgagcgtgatgccaagaagggtctggctaccctgtgcatc
ggtggcggtcagggtgtcgcgctggccatcgagcgcagctga

DBGET integrated database retrieval system