KEGG   Halomonas sp. GFAJ-1: BB497_02895Help
Entry
BB497_02895       CDS       T05375                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hag  Halomonas sp. GFAJ-1
Pathway
hag03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hag00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BB497_02895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hag03011]
    BB497_02895
Ribosome [BR:hag03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BB497_02895
  Bacteria
    BB497_02895
  Archaea
    BB497_02895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF5357
Motif
Other DBs
NCBI-ProteinID: AVI61723
UniProt: H0J2K6
Position
complement(642600..642932)
Genome map
AA seq 110 aa AA seqDB search
MEVTAKLRGARLSAQKARLVADQVRGKPVAEALDLLTFSPKKAAQLVKKVLQSAIANAEE
NNGMDIDELRVSTICVDEGMTLKRIKPRAKGRADRILKRTCHITVKVAEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcacagctaagctgcgtggcgctcgtttatccgcccagaaggcccgtttggtg
gctgaccaggtgcgcggtaaaccggtagccgaggcgctcgacctgctgaccttctcaccg
aagaaggctgctcaattggtcaagaaagtgctgcagtccgccattgcaaacgcggaagaa
aataacggcatggatatcgacgagctgcgtgtctcgaccatctgcgtcgatgagggcatg
acgcttaagcgtatcaagccgcgtgccaaagggcgtgcggatcgtatcttgaagcgcacc
tgccacatcaccgtcaaggtagccgagaagtag

DBGET integrated database retrieval system