KEGG   Halomonas sp. GFAJ-1: BB497_03935Help
Entry
BB497_03935       CDS       T05375                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
hag  Halomonas sp. GFAJ-1
Pathway
hag00860  Porphyrin and chlorophyll metabolism
hag01100  Metabolic pathways
hag01110  Biosynthesis of secondary metabolites
hag01120  Microbial metabolism in diverse environments
Module
hag_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BB497_03935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hag01007]
    BB497_03935
Enzymes [BR:hag01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BB497_03935
Amino acid related enzymes [BR:hag01007]
 Aminotransferase (transaminase)
  Class III
   BB497_03935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVI61909
UniProt: H0J188
Position
complement(865261..866541)
Genome map
AA seq 426 aa AA seqDB search
MTTSAELFDLASRHIPGGVNSPVRAFKGLHRPPVFMERAQGAYLFDVEGNRYVDYVGSWG
PMITGHADQDVLAAVRARLDNGLSFGTPTAVETTMADLLCEMIPTMEMVRMTSSGTEATM
SAIRLARGTTGRDKIVKFEGNYHGHSDSLLVKAGSGALTHGEPSSPGVPASLAEHTITLS
FNDPEGVEACFAEIGEQIACIIVEPVAGNMNCIPPQPGFLETLRRVCNESGSILIFDEVM
TGFRVALGGAQAHYGVTPDLTCLGKIVGGGMPVGAFGGKREIMQNISPLGPVYQAGTLSG
NPLAMAAGVTLLTKLQMPGFHDALTQRVQTLCTGLQERANAARVPMMTQSAGGMFGVFFT
SQSRVDNFAQATACNPDAFRRFFGAMLDHGVYLAPSAYEAGFMSSAHTPEDIQLTLDAAE
KAFSVM
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatctgctgaactgtttgacctcgcgagtcgccatatcccgggtggcgttaac
tcgcctgtccgtgcgtttaaaggcttacatcgcccaccagtatttatggagcgtgctcaa
ggcgcttatctgtttgatgtggagggtaaccgctacgtagattatgttggctcctggggg
ccgatgattactggtcatgctgaccaagacgtactggcagcagtgcgcgcgcgactggat
aacggcctctccttcggtacgccaacggcggttgaaaccaccatggcggatcttctctgc
gagatgatccccaccatggagatggtgcgcatgaccagctcgggcactgaggcgacgatg
tcggccattcgcctagcacgaggtacgacaggacgggacaagattgttaaatttgaaggt
aattaccacggccactcggactcactgcttgttaaggcgggttccggcgcgttaactcac
ggcgaacccagctcgcccggtgtgcccgcttcacttgctgaacacaccattaccctctcg
tttaacgaccctgaaggggttgaggcgtgttttgcagaaatcggtgagcagattgcctgt
attatcgtggagccggttgcgggcaatatgaactgtattcccccccagcctggtttcttg
gaaacgttgcgccgggtgtgtaatgaatccggcagcatcttgatttttgatgaagtcatg
actggcttccgggtcgcgttaggtggtgctcaagcacattacggtgtcacgcccgacctc
acctgcttaggtaaaattgttggcggtggcatgcccgtcggggcgtttggcggtaaacgc
gaaattatgcaaaatatctcgccgctgggaccggtttatcaggcgggtacgctttccggt
aatccgctggccatggccgcaggggttactctgttaaccaagctccagatgccaggcttc
catgatgcgctgactcaacgggtgcaaacgctttgtactggtttgcaagagcgtgctaac
gcagcgcgtgttccgatgatgacccaatccgcaggcggcatgtttggcgttttctttacg
tcgcaatcccgtgtggataactttgctcaggccaccgcttgcaaccctgacgctttccgt
cgcttctttggcgccatgctcgaccacggtgtgtatcttgctccttccgcttatgaagct
ggctttatgtctagcgctcatacaccggaagatattcagctcaccttggatgccgcagaa
aaagccttctctgttatgtaa

DBGET integrated database retrieval system