KEGG   Halomonas sp. GFAJ-1: BB497_04615Help
Entry
BB497_04615       CDS       T05375                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
hag  Halomonas sp. GFAJ-1
Pathway
hag00620  Pyruvate metabolism
hag00630  Glyoxylate and dicarboxylate metabolism
hag01100  Metabolic pathways
hag01110  Biosynthesis of secondary metabolites
hag01120  Microbial metabolism in diverse environments
hag01200  Carbon metabolism
Module
hag_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BB497_04615
   00630 Glyoxylate and dicarboxylate metabolism
    BB497_04615
Enzymes [BR:hag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BB497_04615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AVI62034
UniProt: H0J1M5
Position
complement(998483..1000657)
Genome map
AA seq 724 aa AA seqDB search
MSERITRHRLQVAADLDRFINEQALPGTGVDESAFWAGVDALFHDLTPKNRQLLEKRDVL
QEKLDTWHRENPGPVSDMPAYRRFLKEVGYLVEAPNSVKATTANVDREVAVQAGPQLVVP
VSNARYALNAANARWGSLYDALYGTDAISEENGAEKGSSFNPKRGEKVIAYARGVLDRAA
PLATGSHRDAIKYVIRDEHLVVTLEGGRETGLKDSGKLIGFNGEASAPEAILLANNGLHL
EIQIDASHPIGKTDPAHVKDVVVEAALTAIMDCEDSIAAVDSEDKVGVYRNWLGLMKGDL
EQSIDKGGKTFVRKLNDDRTWKTTDGGSVTLPGRSLLFVRNVGHLMTTPAVLDENGNELP
EGILDAVVTSLIALHDLKKDADQARNSRTGSVYIVKPKMHGPKEVAFANELFSRVEDILG
MSRDTLKMGIMDEERRTTVNLKACIAEATSRVVFINTGFLDRTGDEMHTAMEAGPMVRKG
DMKSAAWISAYEKNNVQIGLACGLRGRAQIGKGMWAMPDLMHSMLEQKIGHPKAGANTAW
VPSPTAAALHALHYHQVNVTDVQRELEAQGEPDYLDDLLTVPVAENPSWSDEEIQQELDN
NCQGILGYVVRWVEHGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLHHGIVDEARVEE
TLKRMAKVVDEQNAGDPTYTAMSANFEGSTAFKAASDLVFKGREQPSGYTEPLLHAWRQV
HKAK
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcgtatcacgcgtcaccgtttacaggtggcagccgacttagaccgcttcatc
aacgagcaggcgctgccggggactggcgtcgacgaaagcgctttttgggccggtgtcgat
gccttgtttcatgatttgacccccaaaaaccgtcaactactcgaaaagcgcgatgtgctg
caagagaagctcgatacctggcaccgtgaaaaccccggtccagtcagcgacatgcctgct
taccgccgctttttgaaagaagtcggttacctcgtcgaggcaccgaacagcgtaaaagcc
accactgccaatgttgaccgtgaagtcgctgttcaagcaggcccacagttggtagtgccg
gtgagcaacgcccgttatgcgctaaatgcggctaacgcgcgctggggcagcctttacgat
gcgctgtacggcaccgatgcaatttcagaagagaatggcgctgagaaaggctccagcttt
aaccccaagcgcggcgaaaaggtgattgcctacgcccgtggcgtgctggaccgcgcagcg
ccgctggccactggctcgcaccgggatgcgattaaatacgttattcgcgacgaacacttg
gtggtcacgctggaaggcggtcgcgaaaccggtttgaaagattccggcaagctgatcggc
tttaacggcgaagcatctgccccagaagcaatcctgctggccaacaacggcctgcacctg
gaaatccagatcgacgccagccatccgatcggtaaaaccgaccccgcccacgtaaaagac
gtggtggtagaagcggcgctaacggccattatggactgcgaagactccattgccgcggtc
gattctgaagataaagtgggtgtataccgtaactggctcggcctgatgaagggcgacctg
gaacaaagcatcgataaaggtggcaaaacgtttgtccgtaagctgaacgatgaccgcaca
tggaaaaccaccgatggcggaagcgtcacgctgcccggccgttcgctgctgtttgtacgt
aacgtgggccacctgatgaccacgccagcggtgctggacgagaacggcaacgagctaccg
gaaggcattctggatgctgtggtcacctcactgattgccctgcacgacctgaaaaaagac
gccgaccaagcgcgtaactcccgcacaggctcggtatatatcgttaagccgaagatgcac
ggtccgaaggaagtggcctttgccaatgaactgttctcccgtgtggaagacattctgggc
atgagccgtgacaccctaaaaatgggcatcatggacgaagagcgccgcaccacggtcaac
ctgaaagcgtgtattgctgaagccacctcccgcgttgtgttcatcaacaccggcttcctc
gaccgcaccggtgacgaaatgcacaccgccatggaagcaggcccgatggttcgcaagggc
gatatgaaaagcgccgcctggatctctgcgtacgagaaaaacaacgtacagatcggcttg
gcctgtggcctgcgcggccgcgcccaaatcggcaaaggcatgtgggccatgccggaccta
atgcacagcatgctggagcagaaaattggtcacccgaaagccggtgccaacaccgcatgg
gtgccgtcgcctaccgctgcggcgctacacgcactgcattaccatcaggtaaacgtcact
gatgttcagcgcgaattagaagcccaaggtgagccagactacctcgatgacctgctaacc
gtaccggtggcggaaaaccccagctggtcggacgaagagatccagcaggagttggacaac
aactgccagggcattctgggttatgttgttcgctgggtagagcacggcgtaggctgctcg
aaagtaccggatatccataacgtcggcttgatggaagaccgcgccacgctgcgtatttcc
agccagcacattgccaactggctgcaccacggcattgtggacgaagcacgggtggaagag
acactgaagcgtatggcgaaagtggtcgatgagcagaacgcgggcgaccccacctacacc
gccatgagcgctaattttgaaggctctactgcctttaaagcggcttcagaccttgtcttc
aaaggccgtgaacagccttccggctacaccgaaccgctactgcacgcgtggcgtcaggtg
cataaagcgaagtaa

DBGET integrated database retrieval system