KEGG   Halomonas sp. GFAJ-1: BB497_05815Help
Entry
BB497_05815       CDS       T05375                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
hag  Halomonas sp. GFAJ-1
Pathway
hag00970  Aminoacyl-tRNA biosynthesis
hag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hag00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BB497_05815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hag03029]
    BB497_05815
Enzymes [BR:hag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BB497_05815
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BB497_05815
Mitochondrial biogenesis [BR:hag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BB497_05815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AVI62257
UniProt: H0J478
Position
complement(1273296..1274693)
Genome map
AA seq 465 aa AA seqDB search
MADTYETLTATDALARFSEGSLSPETLVEDCLTRIERDNPKVNAFTCINGKEARRLAAES
ARRWQAGTPCGSLDGIPVTIKDLTLTKGLPTRLGSTTTVPDGPWEVDAPISRHLRNAGAI
VVGKTTSPEFGWKGVTDNPLHGITRNPWNTELTPGGSSGGAGAAAALNLGLLHQGSDAGG
SIRIPCSFTGTFGIKPTFGWVPQWPASTMSTLSHLGPMTRTAGDSALMLSVMAQPDARDG
YAGNPTGPDWLTPPPASLQGWRIAFSSNLGYVDVAPDIAQRVEEAIAYLEALGATVERTD
PGFSDPLKTFNTLWFAGATQALEKLDEQQQVALDPGFLEIARRGQGVSLSAYLAARRKRS
ELTAHMAAFHERYDLLVTPTMPIAPFTAGHNVPPGKHYRDWMDWTPFSYPFNLTQQPAAS
LPCGLDKQGLPVGLHLVAGKYQDLKVLHAAQLLERYLPPPAPPNC
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcggatacctatgaaaccctgacggcaactgatgcattggcacgtttcagcgagggc
tcgctctcgccggaaacgctggtggaggactgcttaacgcgtattgagcgagataacccc
aaggtgaatgccttcacctgtattaacggtaaagaggcccgccgtttagcagctgaatcc
gcgcgacgctggcaagcaggcactccctgcggctcgctagacggcattccagtgacgatt
aaagacttaaccctaaccaaaggcctgcctacacggctgggttccaccaccacggttccg
gatggcccctgggaggtagatgcgcccattagccgtcacctacgcaatgccggggccatt
gtggttggcaaaaccacctcgcctgaatttggctggaaaggcgtcaccgataacccgctg
cacggcatcacccgcaacccatggaatactgagctaacgccgggagggtcatctggcggc
gcgggggctgccgcggcgcttaacctgggcctgcttcatcagggcagcgacgcgggtggc
tccatacgtattccgtgcagctttaccggcacgtttggtattaaacccactttcggctgg
gtgcctcagtggcctgccagcaccatgagcacgctgtctcatttagggcccatgacacgc
actgcaggtgatagcgccctcatgctcagcgttatggcccagcccgatgcccgggatggt
tacgctggaaacccaacagggccagactggctcacgccgcccccagcgagccttcaaggc
tggcgaatcgcttttagctctaacctgggttacgtagacgtcgctccggatattgcccag
cgagttgaggaagccatcgcttatttagaagcattgggtgccaccgtagaacgcactgac
cctggctttagcgatccgcttaaaacgtttaatacgctctggtttgctggggccacgcag
gcactcgaaaaactcgacgaacagcaacaggtagcgctcgatcctggctttctggagatt
gcacggcgcgggcaaggcgtatcgctttctgcctacctagccgcccggcgtaagcgcagc
gaattgaccgcccacatggccgcctttcacgaacgctatgacttgttggtaacgcctacg
atgcccattgcaccctttacagcgggccacaacgtaccaccgggcaagcactatcgagat
tggatggactggacgccgttcagctatcccttcaacctaacccagcagcccgcggcttcc
cttccctgcgggctagataaacaggggctgccggtaggtttgcacttagtggcggggaaa
tatcaagacctcaaggtgctacatgcggcccagttacttgaacgctatttgccgccacca
gcaccacctaactgctaa

DBGET integrated database retrieval system