KEGG   Halomonas sp. GFAJ-1: BB497_05975Help
Entry
BB497_05975       CDS       T05375                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein B
  KO
K03638  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
hag  Halomonas sp. GFAJ-1
Pathway
hag00790  Folate biosynthesis
hag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BB497_05975
Enzymes [BR:hag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     BB497_05975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: AVI62288
UniProt: H0J5S4
Position
1310610..1311128
Genome map
AA seq 172 aa AA seqDB search
MESMVALNVAVLTVSDTRTEETDRSGQFLIERLTGAGHTLAEKRIVQDDVYQLRAVVAQW
IADPAIQVVITTGGTGFTGRDSTPEAISVLLDKRIEGFGERFRQLSGDEIGSSTIQSRAL
GGFANATVVFCLPGSTGACRTGWDGILAEQLDSRHKPCNFANLVIPGRGQHG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcatggtggcgttaaacgtagcggtgttaacggtgtcggatacgcgcacggaa
gagaccgatcgttcgggccaattcctaatagagcggctcaccggcgcgggccataccctg
gctgaaaagcgcattgtgcaggacgatgtgtatcaacttcgcgcggtggtggcccagtgg
attgccgaccctgcgattcaggtggtgattaccacgggggggacaggctttaccgggcgc
gactccacccccgaggctatctcggtgctgctggataagcgcatcgaaggctttggtgag
cgctttcgccaattgagcggcgacgagatcggtagctccacgattcaaagccgcgctttg
ggtgggtttgccaacgccactgtcgtgttctgtttgcccggctcaaccggtgcgtgccgc
accggctgggacggcattctggccgagcagttggatagccgccataagccgtgcaatttt
gccaacttagtgattccaggccgggggcagcatggctga

DBGET integrated database retrieval system