KEGG   Halomonas sp. GFAJ-1: BB497_08135Help
Entry
BB497_08135       CDS       T05375                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
hag  Halomonas sp. GFAJ-1
Pathway
hag00740  Riboflavin metabolism
hag00790  Folate biosynthesis
hag01100  Metabolic pathways
hag01110  Biosynthesis of secondary metabolites
hag02024  Quorum sensing
Module
hag_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:hag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BB497_08135
   00790 Folate biosynthesis
    BB497_08135
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BB497_08135
Enzymes [BR:hag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BB497_08135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AVI62677
UniProt: H0J5G5
Position
1780943..1782049
Genome map
AA seq 368 aa AA seqDB search
MYHIERAIFDIRRGLPVVVNTSEQRLLVQALEGSASVDSLAALSGSRPALVLTRHRLEAM
GMALTADAACLPLPKHVSEADLHRLALSQESTPLTPALLSGLKPAGVGERGAVALMRRAL
LVPAALSAEVSASAAARIDQQLANGELLEVNARDAEKCLAGAPGMLKRVSEARIPLEDAA
ESRFVLFREPDGLREHVAVVIGQPERLSGAVPMRMHSACLTGDLFGSLRCDCGEQLRNAV
VDIQSMGGGVLLYLAQEGRGIGLANKLRAYTLQDGGLDTVDADQVLGFGDDERQYAVAVD
MLNALDINKVQLLTNNPLKMAALREGGIEVVSRQALYGSVTDHNHRYLSAKANRAGHFLD
DVLEGHGR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacattgaacgcgccatttttgatattcgtcgcggtctgccggtagtggtgaac
accagtgagcagcgtctgctggtgcaagcgttagaaggcagtgcatcggttgacagcttg
gctgcattatcgggttcgcgcccagcgttggtgctaacacgccaccgacttgaggcgatg
ggaatggcattaacagcggatgccgcctgtttaccactacccaagcacgttagtgaagct
gatctgcaccggttggcgctctctcaggagagcacgccgctaacccctgcgctgttgagt
gggctgaagcctgcaggcgtcggtgagcgtggggcggtggcgttaatgcgccgtgcgcta
ttagtccccgcggcgctgagtgccgaggtaagcgcgtcagcggctgcgcgtatcgatcaa
cagttggccaacggtgagctgttggaggttaacgcccgggacgcagagaagtgcttggcg
ggcgccccgggtatgttgaagcgtgttagtgaggcgcgcatccctttggaagacgcggcg
gaaagccgctttgtgctatttcgggagcctgacggcctgcgtgagcatgtagcggtggtg
attggtcagcctgaacgcctttcaggcgcggtgccgatgcgtatgcactctgcttgttta
accggtgatctgtttggcagtttgcgctgtgactgcggcgagcagctgcgtaacgccgtg
gttgatattcaatccatgggcggcggtgtgctgctttacttagcccaagaggggcggggc
attggcctggcaaacaagctacgcgcttatacgctacaagatggcggcctggacacagta
gacgctgaccaggttctcggctttggtgatgacgaacgccaatacgcggtggcggtggat
atgcttaacgcgctggacatcaacaaagtgcagctattaactaacaacccattgaaaatg
gccgccctacgtgaaggcggcattgaggtggtctctcgccaagcgctttatggcagcgtg
accgaccataaccaccgctatttaagcgctaaagccaatcgtgcaggacactttctggat
gatgtgcttgagggtcatggtcggtaa

DBGET integrated database retrieval system