KEGG   Halomonas sp. GFAJ-1: BB497_14045Help
Entry
BB497_14045       CDS       T05375                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
hag  Halomonas sp. GFAJ-1
Pathway
hag00860  Porphyrin and chlorophyll metabolism
hag01100  Metabolic pathways
Module
hag_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:hag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BB497_14045
Enzymes [BR:hag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     BB497_14045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB
Motif
Other DBs
NCBI-ProteinID: AVI63751
UniProt: H0IZ36
Position
complement(3117396..3118847)
Genome map
AA seq 483 aa AA seqDB search
MTTLMIQGTTSDAGKSTVVAGLCRVLKRRGMSVASFKPQNMALNSAVTSDGGEIGRSTAL
QAQAAGVIPHSDMNPVLLKPETDRGAQVILRGKVHGHMDALDYHAFKRTAKESVMAAWQA
LEQRYDVIIAEGAGSPAEINLRKGDIANMGFAEAADCPVLLVGDIDRGGVFAQLVGTLAL
LSDSEQARTKGFIVNRFRGDIALLEPGLEWLEARTDKPVLGTLPYVQGLLLDAEDSIGLT
QAPQASQPLNVIVPALPRMSNHTDFDPLRLHPQVSLTFVGPDRQIPPADVILLPGSKSTA
SDLAWLKRQGWEAAITRHLRYGGKVMGICGGFQMLGEWVDDPEGLEGSPGKVAGLGLLPM
TTRMVAGKQLRNVSGTMVGQDAAVIGYEIHNGISEGAALNQPLLDLGSHRDGAISSDGQI
LGTYVHGVFDHPEACRALLTHLGLKNTVEVDYRAHREKELDRLADTLEAHLDIGAILKML
NVS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactaatgattcaaggcaccacctcggatgcaggaaaaagcaccgtggtggcg
ggtctgtgccgtgttctcaagcgcagggggatgtcggtggcctcgtttaagccccagaac
atggccctgaatagcgcggtgaccagcgatggcggcgagattggccgctccaccgcgcta
caggcccaggctgcaggcgtcattccccatagcgatatgaacccggtactgctgaagccg
gaaactgatcgcggcgcccaggtgattctgcgcggcaaggtgcatggccatatggatgca
ctggattaccatgcgtttaagcgcacagcgaaagagagcgtcatggcagcgtggcaggcc
ttagagcagcgctatgacgtgattattgccgaaggcgcgggtagccctgcggaaatcaac
ctacgtaaaggcgatatcgccaatatgggctttgctgaagctgccgactgcccggtactg
ctggtgggcgatattgatcgtggcggcgtctttgctcagctcgtaggtacgctggcgcta
ttaagtgacagcgagcaggcgcgcaccaaaggttttatcgtgaaccgttttcggggagat
attgcgctgctggagcctgggcttgagtggctagaggcgcgcactgacaagccggtactg
ggtacgctgccctatgtgcaggggttactgttggacgcggaagatagtattggtttaact
caggccccgcaggcaagccagcccctcaacgttatcgttcccgcgctaccgcgcatgagt
aaccacacggatttcgacccactgcgcctgcacccgcaggtatcgctgacgtttgtagga
cctgaccggcagatccccccagcggatgtgattctcctgcccggcagcaaaagtacggcc
agcgacttggcatggcttaagcgccaaggctgggaggcagcgattactcgccacctgcgc
tatggtggcaaagtgatgggtatttgcggtggcttccaaatgctgggtgaatgggtagat
gatccagaagggctagaaggcagtccaggaaaagttgctgggcttggactgctaccgatg
accacgcgaatggtggctggcaagcagttacgcaatgttagtggcacgatggtggggcag
gacgcggcagtgatcggctacgagattcacaatgggattagtgaaggagccgctctaaac
cagccactgcttgacctaggcagccatcgggatggggcaatcagtagcgacggccagata
ttaggtacctatgtgcacggcgtgtttgaccacccggaagcctgccgagcgttgctcacg
cacttaggattaaaaaatacggtggaggtcgattaccgcgcccaccgtgagaaagagctg
gatcgtttggcggacacgctagaagctcacttggatataggcgcgatactcaaaatgctc
aatgttagctaa

DBGET integrated database retrieval system