KEGG   Halomonas sp. GFAJ-1: BB497_15250Help
Entry
BB497_15250       CDS       T05375                                 

Definition
(GenBank) glycosyl transferase
  KO
K13693  glucosyl-3-phosphoglycerate synthase [EC:2.4.1.266]
Organism
hag  Halomonas sp. GFAJ-1
Brite
KEGG Orthology (KO) [BR:hag00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hag01003]
    BB497_15250
Enzymes [BR:hag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.266  glucosyl-3-phosphoglycerate synthase
     BB497_15250
Glycosyltransferases [BR:hag01003]
 Others
  Glycosylglycerate
   BB497_15250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AVI63968
UniProt: H0J270
Position
complement(3381398..3382618)
Genome map
AA seq 406 aa AA seqDB search
MSDFHQNGVITDFHNLTRRSVDALEQELCQFAKRRPMGLILPSLFSELEGPALSAIVDEL
VKVPYLNEVVIGLDRADRDQFLYAREFFSRLPQHTRILWNDGPRLKALDAELESHGLGAL
EPGKGRNVWYCAGYILSSGRSSVVGLHDCDILTYERGLLARLMYPVAHPRFNYSFCKGYY
PRIAEGKLNGRVSRLMVTPLIRALKTVCGPLPYLDYLDSFRYPLSGEFAMRSEVLEGIRI
PADWGLEIGVLSELQRNYAPRQLCQVDIADAYDHKHQPVSEDDPNGGLNRMSLDIAKALY
RKLATQGVSFSSEDFRTLKATYYRYALDLIEAYDHDATMNGLSLDRHCEEQAVELFASNL
LEAGNLFLDNPRERPFIPSWNRVQAAVPDLLARMHDAVELDNQGKV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttccatcaaaatggcgtgattaccgattttcacaacttaacgcgccgttca
gttgacgcacttgagcaagagctttgccaatttgccaagcggcgccccatggggttgatc
ttaccctcgctgttttcagagctggagggaccagcgctttctgccattgtcgatgaatta
gttaaagtgccctatctcaatgaagtggtgattggtctggatcgcgctgatcgcgaccaa
tttttatatgcccgagagtttttttctcgcttaccccagcatactcgtattttatggaac
gacggccctcggttaaaggcgctggatgccgagttggaaagccatgggctaggtgcgctg
gagccgggtaaagggcgcaatgtatggtactgcgcaggctatattctctcgtctgggcgt
tcatcggtggtcggtttacatgactgcgatattctcacctacgagcgtgggttattggcc
cgccttatgtaccccgtggctcatccccggttcaactatagtttttgtaaaggctattac
ccccgcattgcggaggggaagttgaacggacgtgtgtcacggctgatggtaacgccgctc
atacgcgcccttaaaacggtgtgtgggccacttccctacttggattatttggatagcttt
cgttatccgctttccggtgagtttgcgatgcgcagtgaggtactggaaggcatacgtata
ccggcagattgggggctggaaattggtgtgctttccgagttacagcgcaactacgcgcca
aggcagctgtgccaggtcgatattgccgatgcctatgatcacaagcaccagccagtgagt
gaagacgaccctaatggtggcctgaatcgtatgagcctggatattgccaaggcgctgtat
cgcaagctcgctacccaaggcgtgagctttagcagcgaggatttccgtacgctaaaagcg
acctattaccgctatgccttagaccttattgaagcttacgaccacgatgccaccatgaac
gggctcagcttggaccgccattgcgaagagcaggcagtagagctgtttgccagcaacctt
ttagaagcaggtaacctgtttttggataacccacgcgagcgtccgtttatccccagctgg
aaccgagttcaagccgctgtgcccgatttgctggcccgcatgcatgacgcggtggagcta
gataaccaaggaaaggtgtag

DBGET integrated database retrieval system