KEGG   Halophilic archaeon DL31: Halar_2851Help
Entry
Halar_2851        CDS       T01603                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hah  Halophilic archaeon DL31
Pathway
hah00010  Glycolysis / Gluconeogenesis
hah00020  Citrate cycle (TCA cycle)
hah00620  Pyruvate metabolism
hah01100  Metabolic pathways
hah01110  Biosynthesis of secondary metabolites
hah01120  Microbial metabolism in diverse environments
hah01130  Biosynthesis of antibiotics
hah01200  Carbon metabolism
Module
hah_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_2851
   00020 Citrate cycle (TCA cycle)
    Halar_2851
   00620 Pyruvate metabolism
    Halar_2851
Enzymes [BR:hah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Halar_2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AEN06483
UniProt: G2MH88
Position
2063832..2065328
Genome map
AA seq 498 aa AA seqDB search
MAIKEFKLPDVGEGVAEGELVSWAVSVGDAVSEGDIVAEVETDKALVEVPSRYDGKIAEL
HAEEGEIVPVGSVIISFDVDDGAAGGEDAPTAEADDTVEESADTDSDEAAAASTADGRVF
APPSARKLARELGVEIGAVEGTGPGGRVSDADVRAHADAEETEESGEEAAPDAATTEPVG
GTADAETTSTTTAAASGAGADREKTLAVPATRRVAKELDVDIDAVPTAETREGEAFVTEQ
HVREFAEGGAEAGEPATAAAGSATGDQPREETVPYRGIRRTIGDQMAKSKFTAPHVTHHD
TAEIDELVAAREELKATAEEKGSRLTYMAFVLKAVTAALKEYPVLNSELDEEEGVIRLKN
YYNIGIAVATDAGLMVPVVKHVDQKGLLQLADEIQELATKARDRSITRTEMQDGTFTITN
FGAFGGEYATPIINHPETAIMGLGAIKQRPVVQDGEVEAAHTLPLSLAIDHRVIDGAEAA
QFTNAVKSYLAEPTKLLL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaaagagttcaaactacccgacgttggcgaaggcgtcgccgaaggcgaactg
gtctcgtgggcggtgtcggtcggcgatgccgtctccgagggtgacatcgtcgccgaagtc
gagactgacaaggcactggtcgaggtgccctcccgctacgacgggaaaattgccgaactg
cacgccgaagaaggcgaaatcgtccccgtcggctccgtcatcatctccttcgatgtcgat
gatggtgcggctggtggcgaggacgcccccaccgccgaggccgacgacactgtcgaggaa
agcgcagacaccgattccgacgaggccgcagcagcgtcgaccgcagatggtcgtgtgttc
gcgccgccgtccgcccggaagctggcccgcgaactcggcgtcgagataggcgccgtcgag
ggcaccggccccggcggtcgcgtgagtgacgctgacgtgcgcgcccacgccgacgcagag
gagaccgaagagagcggcgaggaagctgctcccgacgcggcgacgaccgaaccggtcggc
ggaacggccgacgccgagacgacctcgacgacgaccgcagccgcctccggcgcgggcgcc
gaccgcgagaagaccctcgcagtgccggcgacccgccgcgtggcgaaggaactcgacgtc
gacatcgacgcggtcccgacagcggaaacccgcgagggcgaggcgttcgtcaccgaacag
cacgtccgagagttcgcagagggcggcgccgaggccggcgagccggcgactgcggccgcc
gggtccgcgaccggcgaccaaccccgtgaggagacggtcccctaccgcggaatccgccgg
accatcggcgaccagatggcgaaatcgaagttcaccgcaccgcacgtcacccaccacgac
acggccgaaatcgacgaactggtggcggcacgtgaggaactcaaggcgaccgcagaggag
aaaggcagccgcctgacctacatggcgttcgtgctgaaggccgtgacggcggcgctcaag
gagtaccccgtcctcaactccgaactcgacgaggaggagggtgtcatccggctgaagaac
tactacaacatcggcatcgccgtcgcgactgacgcggggctgatggtgccggtcgtgaag
cacgtcgaccagaaggggctgctccagttggccgacgagatacaggagttggcgacgaag
gctcgcgaccgctccatcacccgcacggagatgcaggacggcaccttcaccatcaccaac
ttcggggcgttcggcggcgagtacgccaccccgatcatcaaccaccccgagaccgccatc
atggggctcggcgccatcaagcagcggccggtcgtacaggacggcgaggtcgaagcagcc
cacacgctgccgctctccctcgcgatcgaccaccgggtcatcgacggcgcggaagcggca
cagttcaccaacgcggtgaaatcatatctggcggaacccacgaagctactactctaa

DBGET integrated database retrieval system