KEGG   Hahella sp. KA22: ENC22_00530Help
Entry
ENC22_00530       CDS       T05793                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hahe  Hahella sp. KA22
Pathway
hahe00480  Glutathione metabolism
hahe00590  Arachidonic acid metabolism
hahe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hahe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ENC22_00530
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ENC22_00530
Enzymes [BR:hahe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ENC22_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AZZ89743
UniProt: A0A451F5V5
Position
complement(122557..123099)
Genome map
AA seq 180 aa AA seqDB search
MPRFIKTALLSLLLCQSASALAACPALLDGDVKKLHSSQSINLCERFAGKPLVIVNTASY
CGFTPQFKGLEAMYKRYREQGLEVIGMPSDDFNQEDNDAEKTAEVCFVNYGVTFTMTDAH
PVKGPNAHPLFRNLAEQTGQPPQWNFHKYVVDKEGRVVAAFPSRTTPEDPDFIAAVESVL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcccagattcatcaaaacagccttattgagccttttactgtgccaaagcgcgtcagcg
ctggcggcctgccccgccttgctggacggcgacgtcaaaaaactgcactccagccaatcc
atcaatctatgcgaacgcttcgccggcaagccgctggtgatcgttaatacggcgagctac
tgcggttttacccctcagttcaaagggctggaggcgatgtataagcgctatcgggaacaa
ggtctggaagtcatcggcatgccctcggacgactttaatcaggaagacaacgatgcagaa
aaaacggcggaagtgtgtttcgttaattacggcgtcaccttcaccatgacggacgcacat
cctgtcaaaggaccgaacgcgcatcccttgttccgaaatctggcggaacagaccgggcag
cctccgcaatggaactttcataaatatgtggtagacaaggaaggtcgcgtcgtcgccgca
tttcccagtcgcactacgccggaagacccggacttcatcgccgccgtggaaagcgttctc
taa

DBGET integrated database retrieval system