KEGG   Hahella sp. KA22: ENC22_05030Help
Entry
ENC22_05030       CDS       T05793                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
hahe  Hahella sp. KA22
Brite
KEGG Orthology (KO) [BR:hahe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hahe03016]
    ENC22_05030
Enzymes [BR:hahe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ENC22_05030
Transfer RNA biogenesis [BR:hahe03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    ENC22_05030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AZZ90586
UniProt: A0A3T0VH71
Position
1132370..1133116
Genome map
AA seq 248 aa AA seqDB search
MTPLSILYQDEWLVAIDKPSGLLVHRSEIDRHETQFAIQLLRDQIGRRVYPLHRLDKPTS
GVLLFALDSDTAKTCGESWESGVDKTYLAIVRGAPAEEGTIDKPLKEPWDRLGDRNVSKD
KPEQPAVTDYRRLATCELPYAVDRYPTARYSLVRVHPQTGRRHQIRRHFKSLSHPLIGDT
SYGKSVHNRFFAEQFGVQRLLLHAVEMRLPHPHSGEPLTICAPLTGEVLQLLESLDWLNS
IPLEWRKF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgaccccgctcagcattctttatcaagatgaatggctcgtcgccattgataaaccttcc
ggccttttggtgcatcgcagtgaaatcgatcgccatgaaactcagtttgcaatacagctg
cttcgcgatcagatcgggcgtcgggtgtacccgttgcaccgcctggataagccgacttcc
ggcgttctcctgtttgcgctggattccgatactgcaaagacgtgtggcgagtcctgggag
tcaggcgtcgataaaacgtatctggcgattgtgcgcggcgctcccgcagaagaagggacc
atcgacaaaccgttaaaagagccttgggatcgtttgggcgaccgtaacgtcagcaaggac
aaaccggaacagccggcggtaacggattatcggcgtttggcgacgtgtgagttgccttat
gcggtggatcgctatcccactgcgcgttattccctggtcagagtgcatccgcaaactggc
agacgccaccagattcgtcgccacttcaaatcgctgtcgcaccctctgatcggcgatacc
agttacgggaagagcgtgcataatcgcttcttcgctgagcaattcggcgtacagcgtcta
ttattgcatgcggtggaaatgcgtttgccccatccccacagcggcgaacctctgacaatc
tgtgcgccactgacgggagaggtattgcaattgctggaatctctggactggttaaattcg
ataccattggagtggcgaaaattttaa

DBGET integrated database retrieval system